Gå til sidens indhold

ADIAG

Navn

ADIAG

Beskrivende navn

Aktionsdiagnose

Gyldighed

Gyldig fra: 01-01-2005
Gyldig til: Gælder stadig

Databrud

Inden for variabel: Ja
På tværs af variable: Nej

Kvalitetssikring foretaget af

Danmarks Statistik: Ja
Eksterne bedømmere udpeget af KOR: Ja

Generel beskrivelse

ADIAG (Aktionsdiagnose) er diagnosekode iht. "Klassifikation af Sygdomme" jf. International Classification of Diseases (ICD) fra World Health Organization. Der sker løbende ændringer i diagnosekoderne, med koder, der tilføjes og fjernes.

Aktionsdiagnosen er den diagnose, der ved udskrivelse eller afslutning bedst angiver den tilstand, der har ført til indlæggelse, plejebehov eller ambulant besøg, og som er den væsentligste årsag til det gennemførte undersøgelses- og behandlingsprogram.

Registreringen foretages af sygehusene i Landspatientregisteret (LPR). Alle kontakter i LPR skal have en aktionsdiagnose, dvs. der (stort set) ikke er missing values på variablen, ej heller ugyldige diagnosekoder.

Startår angivet til 2005 gælder alene for stationære indlæggelser ved patienttype 0 (indlagt patient). Hvad angår ambulante indlæggelser ved patienttype 2 (ambulant patient) samt skadestuebesøg patienttype 3 er startår 2006.

Detaljeret beskrivelse

Diagnoseklassifikation, som følger den officielle "klassifikation af sygdomme" kan ses i Sygehusvæsnets Klassifikationssystems SKS-browser fra National Sundheds-it på http://www.medinfo.dk/sks/brows.php?s_nod=5717.
Bemærk at der her alene vises aktuelt gældende diagnosekoder.
SKS er baseret på den internationale klassifikation af sygdomme fra WHO. I Landspatientregisteret fra Sundhedsdatastyrelsen er International Classification of Diseases version ICD8 anvendt til og med 1993. Fra 1994 bruges International Classification of Diseases version ICD10.

På detaljeret diagnoseniveau som ADIAG er det ikke muligt at arbejde med konsistente dataserier før og efter 1994. I stedet kan diagnosegrupperingerne DIAG23 og DIAG99 anvendes.

Sygehusene indberetter aktionsdiagnose til Landspatientregisteret. De indberetter også bi-diagnoser og henvisningsdiagnoser, som supplerer aktionsdiagnosen med information til det kliniske billede af patienten.
I SBR anvendes alene aktionsdiagnose i diagnosevariablene, Henvisnings- og bidiagnoser medtages ikke.

Værdisæt indeholder såvel detaljerede koder som koder på et mere overordnet niveau. Koder på overordnet niveau forekommer ikke i SBR-data. Værdisæt indeholder ICD10-koder som var gældende fra 1994 og koder som siden er tilføjet.

Der er anført databrud indenfor variablen, idet der løbende foretages justeringer af ICD10-klassifikationen.

Værdisæt

D282170.TXT_DIAG - Aktionsdiagnose
Kode tekst Fra dato Til dato
D Klassifikation af sygdomme og helbredsrelaterede tilstande 01-01-1994
DA00 Kolera 01-01-1994
DA000 Kolera forårsaget af Vibrio cholerae 01-01-1994
DA001 Kolera forårsaget af Vibrio cholerae eltor 01-01-1994
DA009 Kolera UNS 01-01-1994
DA01 Tyfus og paratyfus 01-01-1994
DA010 Tyfus 01-01-1994
DA011 Paratyfus A 01-01-1994
DA012 Paratyfus B 01-01-1994
DA013 Paratyfus C 01-01-1994
DA014 Paratyfus UNS 01-01-1994
DA02 Andre salmonellainfektioner 01-01-1994
DA020 Salmonellaenterit 01-01-1994
DA021 Salmonellasepsis 01-01-1994
DA022 Lokaliseret salmonellainfektion 01-01-1994
DA022A Salmonella arthritis 01-01-1994 31-12-2011
DA022B Salmonella infektion, renal tubulo-interstitiel 01-01-1994 31-12-2011
DA022C Salmonella meningitis 01-01-1994 31-12-2011
DA022D Salmonella osteomyelitis 01-01-1994 31-12-2011
DA022E Salmonella pneumoni 01-01-1994 31-12-2011
DA028 Anden salmonellainfektion 01-01-1994
DA029 Salmonellainfektion UNS 01-01-1994
DA03 Bacillær dysenteri 01-01-1994
DA030 Dysenteri forårsaget af Shigella dysenteriae 01-01-1994
DA031 Dysenteri forårsaget af Shigella flexneri 01-01-1994
DA032 Dysenteri forårsaget af Shigella boydii 01-01-1994
DA033 Dysenteri forårsaget af Shigella sonnei 01-01-1994
DA038 Anden bacillær dysenteri 01-01-1994
DA039 Bacillær dysenteri UNS 01-01-1994
DA04 Andre bakterielle tarminfektioner 01-01-1994
DA040 Enteritis f.a. enteropatogen Escherichia coli-infektion 01-01-1994
DA041 Enteritis f.a. enterotoksisk Escherichia coli-infektion 01-01-1994
DA042 Enteritis f.a. enteroinvasiv Escherichia coli-infektion 01-01-1994
DA043 Enteritis f.a. enterohæmoragisk Escherichia coli-infektion 01-01-1994
DA044 Anden tarminfektion med Escherichia coli 01-01-1994
DA045 Enteritis forårsaget af Campylobacter 01-01-1994
DA046 Enteritis forårsaget af Yersinia enterocolitica 01-01-1994
DA047 Enterokolitis forårsaget af Clostridium difficile 01-01-1994
DA048 Anden bakteriel enteritis 01-01-1994
DA049 Enteritis forårsaget af bakterier UNS 01-01-1994
DA05 Andre bakterielle fødevareforgiftninger IKA 01-01-1994
DA050 Fødevareforgiftning forårsaget af stafylokokker 01-01-1994
DA051 Botulisme 01-01-1994
DA052 Fødevareforgiftning forårsaget af Clostridium perfringens 01-01-1994
DA053 Fødevareforgiftning forårsaget af Vibrio parahaemolyticus 01-01-1994
DA054 Fødevareforgiftning forårsaget af Bacillus cereus 01-01-1994
DA058 Anden bakteriel fødevareforgiftning 01-01-1994
DA059 Bakteriel fødevareforgiftning UNS 01-01-1994
DA06 Amøbedysenteri 01-01-1994
DA060 Akut amøbedysenteri 01-01-1994
DA061 Kronisk intestinal amøbeinfektion 01-01-1994
DA062 Colitis forårsaget af amøbeinfektion 01-01-1994
DA063 Amøbom i tarmen 01-01-1994
DA063A Amøbom UNS 01-01-1994
DA064 Leverabsces forårsaget af amøbeinfektion 01-01-1994
DA065 Lungeabsces forårsaget af amøbeinfektion 01-01-1994
DA066 Hjerneabsces forårsaget af amøbeinfektion 01-01-1994
DA067 Amøbeinfektion i huden 01-01-2012
DA068 Amøbeinfektion med anden lokalisation 01-01-1994
DA068A Appendicitis forårsaget af amøbeinfektion 01-01-1994
DA068B Balanitis amoebica 01-01-1994 31-12-2011
DA069 Amøbeinfektion UNS 01-01-1994
DA07 Andre tarmsygdomme fremkaldt af protozoer 01-01-1994
DA070 Balantidiasis 01-01-1994
DA071 Giardiasis 01-01-1994
DA071A Lambliasis 01-01-1994 31-12-2011
DA072 Cryptosporidiosis 01-01-1994
DA073 Isosporiasis 01-01-1994
DA073A Coccidiosis intestinalis 01-01-1994 31-03-2018
DA078 Anden tarminfektion forårsaget af protozoer 01-01-1994
DA078A Sarcocystose 01-01-1994
DA078B Sarcosporidiose 01-01-1994 31-03-2018
DA078C Trichomoniasis intestinalis 01-01-1994
DA078D Coccidiosis intestinalis 01-04-2018
DA079 Tarmsygdom forårsaget af protozoer UNS 01-01-1994
DA08 Tarminfektioner forårsaget af virus og andre organismer 01-01-1994
DA080 Enteritis forårsaget af rotavirus 01-01-1994
DA081 Akut gastroenteritis forårsaget af Norwalk-virus 01-01-1994
DA082 Enteritis forårsaget af adenovirus 01-01-1994
DA083 Enteritis forårsaget af anden virus 01-01-1994
DA083A Gastroenteritis forårsaget af parvovirus 01-01-1994
DA084 Tarminfektion forårsaget af virus UNS 01-01-1994
DA085 Tarminfektion forårsaget af anden (mikro)organisme UNS 01-01-1994
DA09 An. gastroenteritis og colitis af infekt./ikke spec. årsag 01-01-1994
DA090 An. og uspec gastroenteritis og colitis af infektiøs oprind. 01-01-2013
DA099 Gastroenteritis eller colitis af ikke specificeret årsag 01-01-1994
DA15 TB i ånde-org. verif. bakt. og hist. 01-01-1994
DA150 Lunge-TB verif. v. mikroskopi af ekspektorat m./u. dyrkning 01-01-1994
DA150A Bronchiectasis tuberculosa, bakteriologisk verificeret 01-01-1994 31-12-2011
DA150B Fibrosis pulmonis tuberculosa, bakteriologisk verificeret 01-01-1994 31-12-2011
DA150C Pneumonia tuberculosa, bakteriologisk verificeret 01-01-1994 31-12-2011
DA150D Pneumothorax tuberculosa, bakteriologisk verificeret 01-01-1994 31-12-2011
DA151 Lungetuberkulose verificeret alene ved dyrkning 01-01-1994
DA152 Lungetuberkulose verificeret histologisk 01-01-1994
DA153 Lungetuberkulose verificeret ved ikke angivet metode 01-01-1994
DA154 TB i intratorakale lymfeknuder verificeret bakt. eller hist. 01-01-1994
DA154A Tuberculosis lymphonodorum hili, bakt og hist verificeret 01-01-1994 31-12-2011
DA154B Tuberculosis lymphonodorum mediast, bakt og hist verificere 01-01-1994 31-12-2011
DA154C Tuberculosis lymphonodorum tracheobronch, bakt og hist veri 01-01-1994 31-12-2011
DA155 TB i struben, luftrøret el. bronkier verif. bakt. el. hist. 01-01-1994
DA155A Tuberculosis bronchi, bakt og hist verificeret 01-01-1994 31-12-2011
DA155B Tuberculosis glottidis, bakt og hist verificeret 01-01-1994 31-12-2011
DA155C Tuberculosis laryngis, bakt og hist verificeret 01-01-1994 31-12-2011
DA155D Tuberculosis tracheae, bakt og hist verificeret 01-01-1994 31-12-2011
DA156 Tuberkuløs lungehindebetændelse verificeret bakt. el. hist. 01-01-1994
DA156A Empyema pleurae tuberculosa, bakt og hist verificeret 01-01-1994 31-12-2011
DA157 Primær TB i åndedrætsorganerne verificeret bakt. eller hist. 01-01-1994
DA158 An. TB i åndedrætsorganerne verif. bakt. og hist. 01-01-1994
DA158A TB i mediastinum verif. bakt. og hist. 01-01-1994
DA158B TB i næsen verif. bakt. og hist. 01-01-1994
DA158C TB i næsesvælget verif. bakt. og hist. 01-01-1994
DA159 TB i åndedrætsorganerne UNS, verificeret bakt. eller hist. 01-01-1994
DA16 TB i åndedrætsorganer ikke bakt. eller hist. verificeret 01-01-1994
DA160 Lungetuberkulose, bakt. og hist. negativt fund 01-01-1994
DA160A Bronchiectasia tuberculosa, bakt og hist negativ 01-01-1994 31-12-2011
DA160B Fibrosis pulmonis tuberculosa, bakt og hist negativ 01-01-1994 31-12-2011
DA160C Pneumonia tuberculosa, bakt og hist negativ 01-01-1994 31-12-2011
DA160D Pneumothorax tuberculosa, bakt og hist negativ 01-01-1994 31-12-2011
DA161 Lungetuberkulose, bakt. og hist. unds. ikke er foretaget 01-01-1994
DA162 Lunge-TB uden bakteriologisk eller histologisk verifikation 01-01-1994
DA162A Tuberkuløs lungefibrose UNS 01-01-1994
DA162B Tuberkuløs pneumoni UNS 01-01-1994
DA162C Tuberkuløs pneumothorax UNS 01-01-1994
DA162D Tuberculosis pulm u spec u ang af verifikationsmåde 01-01-1994 31-12-2011
DA163 TB i intratorakale lymfekirtler u. bakt. el. hist. verif. 01-01-1994
DA164 TB i strube, luftrør el. bronkier u. bakt. el. hist. verif. 01-01-1994
DA164A Tuberculosis bronchi uden angivelse af verifikationmåde 01-01-1994 31-12-2011
DA164B Tuberculosis glottidis uden angivelse af verifikationsmåde 01-01-1994 31-12-2011
DA164C Tuberculosis laryngis uden angivelse af verifikationsmåde 01-01-1994 31-12-2011
DA164D Tuberculosis tracheae uden angivelse af verifikationsmåde 01-01-1994 31-12-2011
DA165 Tuberkuløs lungehindebetæn. u. ang. af bakt. el. hist. veri. 01-01-1994
DA165A Empyema pleurae tuberculosa uden ang af verifikationmåde 01-01-1994 31-12-2011
DA167 Primær TB i åndedrætsorganerne uden bakt. el. hist. verif. 01-01-1994
DA168 An. TB i åndedrætsorganerne u. bakt. el. hist. verif. 01-01-1994
DA168A Tuberkulose i mediastinum UNS 01-01-1994
DA168B Tuberkulose i næsen UNS 01-01-1994
DA168C Tuberkulose i næsesvælget UNS 01-01-1994
DA169 TB i åndedrætsorganerne UNS, uden bakt. el. hist. verif. 01-01-1994
DA17 Tuberkulose i nervesystemet 01-01-1994
DA170 Tuberkuløs meningitis 01-01-1994
DA170A Tuberkuløs meningitis 01-01-1994 31-12-2011
DA171 Tuberkulom i hjernehinder 01-01-1994
DA178 Anden form for tuberkulose i nervesystemet 01-01-1994
DA178A Abscessus cerebri tuberculosus 01-01-1994 31-12-2011
DA178B Neuritis tuberculosa 01-01-1994 31-12-2011
DA178C Tuberculoma medullae spinalis 01-01-1994 31-12-2011
DA178D Tuberculosis cerebri 01-01-1994 31-12-2011
DA178E Tuberculosis medullae spinalis 01-01-1994 31-12-2011
DA179 Tuberkulose i nervesystemet UNS 01-01-1994
DA18 Tuberkulose i andre organer 01-01-1994
DA180 Tuberkulose i knogler og led 01-01-1994
DA180A Necrosis ossis tuberculosa 01-01-1994 31-12-2011
DA180B Ostitis tuberculosa 01-01-1994 31-12-2011
DA180C Tendovaginitis tuberculosa 01-01-1994 31-12-2011
DA180D Tuberculosis articuli 01-01-1994 31-12-2011
DA180E Tuberculosis columnae vertebralis 01-01-1994 31-12-2011
DA180F Tuberculosis coxae 01-01-1994 31-12-2011
DA180G Tuberculosis genus 01-01-1994 31-12-2011
DA181 Tuberkulose i urinveje og kønsorganer 01-01-1994
DA181A Tuberculosis cervicis uteri 01-01-1994 31-12-2011
DA181B Tuberculosis organorum genitalium feminae 01-01-1994 31-12-2011
DA181C Tuberculosis organorum genitalium viri 01-01-1994 31-12-2011
DA181D Tuberculosis renis 01-01-1994 31-12-2011
DA181E Tuberculosis ureteris 01-01-1994 31-12-2011
DA181F Tuberculosis vesicae urinariae 01-01-1994 31-12-2011
DA182 Tuberkulose i perifere lymfeknuder 01-01-1994
DA183 Tuberkulose i tarm, bughinde og mesenteriale lymfeknuder 01-01-1994
DA183A FEJLOPRETTET 01-01-1994 01-01-2012
DA183B FEJLOPRETTET 01-01-1994 01-01-2012
DA183C FEJLOPRETTET 01-01-1994 01-01-2012
DA183D Tuberculosis mesenterii 01-01-1994 31-12-2011
DA183E Tuberculosis peritonei 01-01-1994 31-12-2011
DA183F Tuberkulose i retroperitoneale lymfeknuder 01-01-2012
DA183G Tuberkuløs ascites 01-01-2012
DA183H Tuberkulose i mesenteriale lymfeknuder 01-01-2012
DA184 Tuberkulose i hud og underhud 01-01-1994
DA184A Lupus 01-01-1994
DA184B Lupus excedens 01-01-1994
DA184C Lupus vulgaris 01-01-1994
DA184D Scrofuloderma 01-01-1994
DA184E Tuberculosis cutis 01-01-1994 31-12-2011
DA184F Tuberculosis lichenoides 01-01-1994
DA184G Tuberculosis subcutis 01-01-1994
DA184H Tuberculosis verrucosa cutis 01-01-1994
DA184I Erythema induratum Bazin 01-04-2000
DA184J Lichen scrofulosorum 01-01-2010
DA185 Tuberkulose i øje 01-01-1994
DA185A Chorioretinitis disseminata tuberculosa 01-01-1994 31-12-2011
DA185B Iridocyclitis chronica tuberculosa 01-01-1994 31-12-2011
DA185C Keratitis interstitialis tuberculosa 01-01-1994 31-12-2011
DA185D Keratoconjunctivitis (phlyctaenulosa) tuberculosa 01-01-1994 31-12-2011
DA186 Tuberkulose i øre 01-01-1994
DA187 Tuberkulose i binyre 01-01-1994
DA187A Tuberkuløs Addisons sygdom 01-01-1994
DA188 Tuberkulose i andet organ 01-01-1994
DA188A Arteritis cerebralis tuberculosa 01-01-1994 31-12-2011
DA188B Erythema induratum 01-01-1994 31-12-2011
DA188C Tuberculosis endocardii 01-01-1994 31-12-2011
DA188D Tuberculosis glandulae thyreoideae 01-01-1994 31-12-2011
DA188E Tuberculosis lienis 01-01-1994 31-12-2011
DA188F Tuberculosis myocardii 01-01-1994 31-12-2011
DA188G Tuberculosis oesophagi 01-01-1994 31-12-2011
DA188H Tuberculosis pericardii 01-01-1994 31-12-2011
DA19 Miliær tuberkulose 01-01-1994
DA190 Akut miliær tuberkulose med enkelt specificeret lokalisation 01-01-1994
DA191 Akut miliær tuberkulose med flere lokalisationer 01-01-1994
DA192 Akut miliær tuberkulose UNS 01-01-1994
DA198 Anden miliær tuberkulose 01-01-1994
DA199 Miliær tuberkulose UNS 01-01-1994
DA20 Pest 01-01-1994
DA200 Byldepest 01-01-2012
DA201 Hudpest 01-01-2012
DA202 Lungepest 01-01-2012
DA203 Meningitis forårsaget af Yersenia pestis 01-01-2012
DA207 Sepsisk pest 01-01-2012
DA208 Anden form for pest 01-01-2012
DA209 Pest UNS 01-01-1994
DA21 Tularæmi 01-01-1994
DA210 Ulceroglandulær tularæmi 01-01-2012
DA211 Okuloglandulær tularæmi 01-01-2012
DA212 Pulmonal tularæmi 01-01-2012
DA213 Gastrointestinal tularæmi 01-01-2012
DA217 Tyføs tularæmi 01-01-2012
DA218 Anden form for tularæmi 01-01-2012
DA219 Tularæmi UNS 01-01-1994
DA219A Deer fly fever 01-01-1994 31-12-2011
DA22 Miltbrand 01-01-1994
DA220 Kutan miltbrand 01-01-2012
DA221 Pulmonal miltbrand 01-01-2012
DA222 Gastrointestinal miltbrand 01-01-2012
DA227 Miltbrandsepsis 01-01-2012
DA228 Anden form for miltbrand 01-01-2012
DA229 Miltbrand UNS 01-01-1994
DA229A Anthrax intestini 01-01-1994 31-12-2011
DA229B Anthrax septicaemia 01-01-1994 31-12-2011
DA229C Meningitis anthracis 01-01-1994 31-12-2011
DA229D Pustula maligna 01-01-1994 31-12-2011
DA23 Svingefeber 01-01-1994
DA230 Brucellose forårsaget af Brucella melitensis 01-01-2012
DA231 Brucellose forårsaget af Brucella abortus 01-01-2012
DA232 Brucellose forårsaget af Brucella suis 01-01-2012
DA233 Brucellose forårsaget af Brucella canis 01-01-2012
DA238 Anden brucellose 01-01-2012
DA239 Brucellose UNS 01-01-1994
DA239A Brucellosis 01-01-1994 31-12-2011
DA239B Febris Malta 01-01-1994 31-12-2011
DA239C Febris mediterranea 01-01-1994 31-12-2011
DA239D Svingefeber 01-01-1994 31-12-2011
DA24 Glanders og melioidosis 01-01-1994
DA240 Glanders 01-01-1994
DA240A Malleus 01-01-1994 31-12-2011
DA241 Akut eller fulminant melioidose 01-01-2012
DA242 Subakut eller kronisk melioidose 01-01-2012
DA243 Anden form for melioidose 01-01-2012
DA244 Melioidose UNS 01-01-1994
DA25 Rottebidfeber sygdomme 01-01-1994
DA250 Spirillose 01-01-2012
DA250A Sodoku 01-01-2012
DA251 Streptobacillose 01-01-2012
DA259 Rottebidfeber UNS 01-01-1994
DA26 Svinerosen 01-01-1994
DA260 Kutant erysipeloid 01-01-2012
DA267 Sepsis forårsaget af Erysipelothrix rhusiopathiae 01-01-2012
DA268 Anden form for erysipeloid 01-01-2012
DA269 Erysipeloid UNS 01-01-1994
DA27 Leptospirose 01-01-1994
DA270 Weils sygdom 01-01-1994
DA278 Anden leptospirose 01-01-1994
DA278A Leptospirosis Australiae 01-01-1994 31-12-2011
DA278B Leptospirosis Bataviae 01-01-1994 31-12-2011
DA278C Leptospirosis pyrogenes 01-01-1994 31-12-2011
DA278D Leptospirosis Sejrø, Saxkøbing 01-01-1994 31-12-2011
DA279 Leptospirose UNS 01-01-1994
DA28 Andre dyreoverførte bakterielle infektioner IKA 01-01-1994
DA280 Pasteurellose 01-01-1994
DA281 Kattekradsningsfeber 01-01-1994
DA282 Yersinia infektion udenfor mave-tarm-kanalen 01-01-1994
DA282A Arthritis Yersenia enterocolica 01-01-1994 31-12-2011
DA282B Yersinia sepsis 01-01-1994
DA282C Yersinia eksantem 01-01-2000 31-12-2011
DA288 Anden dyreoverført bakteriel infektion 01-01-1994
DA289 Dyreoverført bakteriel infektion UNS 01-01-1994
DA30 Spedalskhed 01-01-1994
DA300 Tidlig spedalskhed 01-01-2012
DA301 Tuberkuloid spedalskhed 01-01-2012
DA302 Borderline tuberkuloid spedalskhed 01-01-2012
DA303 Borderline spedalskhed 01-01-2012
DA304 Borderline lepromatøs spedalskhed 01-01-2012
DA305 Lepromatøs spedalskhed 01-01-2012
DA308 Anden form for spedalskhed 01-01-2012
DA309 Spedalskhed UNS 01-01-1994
DA31 Sygdomme forårsaget af andre mykobakterier 01-01-1994
DA310 Mykobakteriel lungeaffektion 01-01-1994
DA310A Lungeinfektion med Mycobacterium avium 01-01-1994
DA310B Lungeinfektion med Mycobacterium intracellularis 01-01-1994
DA310C Lungeinfektion med Mycobacterium kansasii 01-01-1994
DA311 Mykobakteriel hudaffektion 01-01-1994
DA311A Hudinfektion med Mycobacterium marinum 01-01-1994
DA311B Hudinfektion med Mycobacterium ulcerans 01-01-1994
DA311C Ulcus Buruli 01-01-1994 31-12-2011
DA318 Anden mykobakteriel infektion 01-01-1994
DA319 Mykobakteriel infektion UNS 01-01-1994
DA32 Listeriose 01-01-1994
DA320 Listeriose i huden 01-01-1994
DA321 Listeriose i centralnervesystemet 01-01-1994
DA321A Listeria meningitis 01-01-1994 31-12-2011
DA321B Listeria meningoencephalitis 01-01-1994 31-12-2011
DA327 Listeriasepsis 01-01-1994
DA328 Anden form for listeriose 01-01-1994
DA328A Okuloglandulær listeriosis 01-01-2012
DA329 Listeriose UNS 01-01-1994
DA33 Stivkrampe hos nyfødte 01-01-1994
DA339 Stivkrampe hos nyfødt 01-01-1994
DA34 Obstetrisk stivkrampe 01-01-1994
DA349 Stivkrampe i barselsperioden 01-01-1994
DA35 Anden form for stivkrampe 01-01-1994
DA359 Stivkrampe IKA 01-01-1994
DA36 Difteri 01-01-1994
DA360 Svælgdifteri 01-01-1994
DA360A Tonsildifteri 01-01-2012
DA361 Difteri i nasopharynx 01-01-1994
DA361A Pharyngitis diphtherica 01-01-1994 31-12-2011
DA362 Larynxdifteri 01-01-1994
DA362A Difterisk laryngotrakeitis 01-01-1994
DA363 Difteri i huden 01-01-1994
DA368 Anden form for difteri 01-01-1994
DA368A Conjunctivitis diphtherica 01-01-1994 31-12-2011
DA368B Diphtheria nasalis 01-01-1994 31-12-2011
DA368C Myocarditis diphtherica 01-01-1994 31-12-2011
DA368D Polyneuritis diphtherica 01-01-1994 31-12-2011
DA369 Difteri UNS 01-01-1994
DA37 Kighoste 01-01-1994
DA370 Kighoste forårsaget af Bordetella pertussis 01-01-1994
DA371 Kighoste forårsaget af Bordetella parapertussis 01-01-1994
DA378 Kighoste forårsaget af anden Bordetella-type 01-01-1994
DA379 Kighoste UNS 01-01-1994
DA38 Skarlagensfeber 01-01-1994
DA389 Skarlagensfeber UNS 01-01-1994
DA39 Infektioner med meningokokker 01-01-1994
DA390 Meningitis forårsaget af meningokokker 01-01-1994
DA391 Waterhouse-Friderichsens syndrom 01-01-1994
DA392 Akut meningokokbakteriæmi 01-01-1994
DA392A Meningokoksepsis 01-01-1996
DA393 Kronisk meningokokbakteriæmi 01-01-1994
DA394 Meningokokbakteriæmi UNS 01-01-1994
DA395 Hjertesygdom forårsaget af meningokokker 01-01-1994
DA395A Carditis meningococcica 01-01-1994 31-12-2011
DA395B Endocarditis meningococcica 01-01-1994 31-12-2011
DA398 Anden meningokokinfektion 01-01-1994
DA398A Arthritis postmeningococcica 01-01-1994 31-12-2011
DA398B Neuritis nervi optici meningococcica 01-01-1994 31-12-2011
DA399 Meningokokinfektion UNS 01-01-1994
DA40 Sepsis forårsaget af streptokokker 01-01-1994
DA400 Sepsis forårsaget af Streptococcus A 01-01-1994
DA401 Sepsis forårsaget af Streptococcus B 01-01-1994
DA402 Sepsis forårsaget af Streptococcus D og Enterococcus 01-01-1994
DA403 Sepsis forårsaget af Streptococcus pneumoniae 01-01-1994
DA408 Anden streptokoksepsis 01-01-1994
DA409 Streptokoksepsis UNS 01-01-1994
DA41 Anden sepsis 01-01-1994
DA410 Sepsis forårsaget af Staphylococcus aureus 01-01-1994
DA411 Sepsis forårsaget af anden stafylokok 01-01-1994
DA411A Sepsis forårsaget af koagulase-negative stafylokokker 01-01-1994
DA412 Sepsis forårsaget af stafylokokker UNS 01-01-1994
DA413 Sepsis forårsaget af Haemophilus influenzae 01-01-1994
DA414 Sepsis forårsaget af anaerob bakterie 01-01-1994
DA415 Sepsis forårsaget af anden gramnegativ organisme 01-01-1994
DA415A Sepsis forårsaget af Escherichia coli 01-01-2016
DA418 Anden sepsis IKA 01-01-1994
DA419 Sepsis UNS 01-01-1994
DA419A Septisk shock 01-01-1994 31-12-2012
DA419B Urosepsis 01-01-2000
DA419C Svær sepsis 01-01-2013
DA42 Aktinomykose 01-01-1994
DA420 Pulmonal aktinomykose 01-01-1994
DA421 Abdominal aktinomykose 01-01-1994
DA422 Cervikofacial aktinomykose 01-01-1994
DA427 Sepsis forårsaget af aktinomykose 01-01-1994
DA428 Anden form for aktinomykose 01-01-1994
DA429 Aktinomykose UNS 01-01-1994
DA43 Nocardiose 01-01-1994
DA430 Pulmonal nocardiose 01-01-2012
DA431 Kutan nocardiose 01-01-2012
DA438 Anden form for nocardiose 01-01-2012
DA439 Nocardiose UNS 01-01-1994
DA44 Bartonellose 01-01-1994
DA440 Systemisk bartonellose 01-01-2012
DA441 Kutan og mukokutan bartonellose 01-01-2012
DA448 Anden form for bartonellose 01-01-2012
DA449 Bartonellose UNS 01-01-1994
DA46 Rosen 01-01-1994
DA469 Rosen UNS 01-01-1994
DA48 Andre bakterielle sygdomme IKA 01-01-1994
DA480 Gasgangræn 01-01-1994
DA481 Legionærsygdom 01-01-1994
DA482 Pontiacfeber 01-01-1994
DA483 Toksisk shock-syndrom 01-01-1994
DA484 Brasiliansk purpurafeber 01-01-1994
DA484A Systemisk Haemophilus aegypticus-infektion 01-01-1994
DA488 Anden bakteriel sygdom 01-01-1994
DA488A Trichomycosis axillaris 01-04-2000
DA49 Bakteriel infektion uden angivelse af lokalisation 01-01-1994
DA490 Stafylokokinfektion UNS 01-01-1994
DA491 Streptokok- og/eller enterokokinfektion, uspec lokalisation 01-01-1994
DA491A Perianal streptokokinfektion 01-04-2000 31-12-2011
DA492 Infektion med Haemophilus influenzae UNS 01-01-1994
DA493 Mycoplasmainfektion UNS 01-01-1994
DA498 Anden bakteriel infektion uden angivelse af lokalisation 01-01-1994
DA499 Bakteriel infektion UNS 01-01-1994
DA499A Bakteriæmi UNS 01-01-1996
DA50 Medfødt syfilis 01-01-1994
DA500 Tidlig medfødt symptomgivende syfilis 01-01-1994
DA501 Tidlig medfødt latent syfilis 01-01-1994
DA501A Syfilis, medfødt seropositiv uden kliniske manifestationer 01-01-1994 31-12-2011
DA502 Tidlig medfødt syfilis UNS 01-01-1994
DA503 Sen medfødt syfilitisk øjenlidelse 01-01-1994
DA504 Sen medfødt neurosyfilis 01-01-1994
DA505 Anden sen medfødt symptomatisk syfilis 01-01-1994
DA505A Hutchinsons triade 01-01-1994
DA505B Hutchinsons tænder 01-01-1994
DA505C Syfilitisk saddelnæse 01-01-1994
DA506 Sen medfødt seropositiv syfilis u kliniske manifest. 01-01-1994
DA507 Sen medfødt syfilis UNS 01-01-1994
DA509 Medfødt syfilis UNS 01-01-1994
DA51 Frisk syfilis 01-01-1994
DA510 Primær genital syfilis 01-01-1994
DA510A Chanker syphiliticum 01-01-1994 31-12-2011
DA511 Primær anal syfilis 01-01-1994
DA512 Primær syfilis med anden lokalisation 01-01-1994
DA513 Sekundær syfilis i hud eller slimhinder 01-01-1994
DA513A Condyloma syphiliticum 01-01-1994
DA513B Håraffald, syfilitisk 01-01-1994 31-12-2011
DA513C Syphilis secundaria cutanea 01-01-1994 31-12-2011
DA513D Syphilis secundaria mucosae 01-01-1994 31-12-2011
DA513E Roseola syphilitica 01-04-2000 31-12-2011
DA513F Syfilitisk mukøst plaque 01-01-2012
DA514 Anden sekundær syfilis 01-01-1994
DA514A Syfilitisk lymfeknudesvulst 01-01-1994
DA514B Meningitis syphilitica 01-01-1994 31-12-2011
DA515 Frisk latent syfilis 01-01-1994
DA519 Frisk syfilis UNS 01-01-1994
DA52 Syfilis i sent stadium 01-01-1994
DA520 Kardiovaskulær syfilis 01-01-1994
DA520A Aneurisma aortae syphilitica 01-01-1994 31-12-2011
DA520B Aortitis, syfilitisk 01-01-1994 31-12-2011
DA521 Sen symptomatisk neurosyfilis 01-01-1994
DA521A Neurosyphilis symptomatica 01-01-1994 31-12-2011
DA521B Paralysis generalis syphilitica 01-01-1994 31-12-2011
DA521C Polyneuropathia syphilitica 01-01-1994 31-12-2011
DA521D Tabes dorsalis 01-01-1994
DA522 Asymptomatisk neurosyfilis 01-01-1994
DA523 Neurosyfilis UNS 01-01-1994
DA527 Anden form for sen symptomatisk syfilis 01-01-1994
DA527A Syfilitisk gumma 01-01-1994
DA527B Syfilis i knogle uden angivelse af stadium 01-01-1994 31-12-2011
DA527C Anden form for sen eller tertiær syfilis 01-01-2012
DA528 Sen latent syfilis 01-01-1994
DA529 Syfilis i sent stadium UNS 01-01-1994
DA53 Anden syfilis og syfilis UNS 01-01-1994
DA530 Latent syfilis uden specificering af stadie 01-01-1994
DA538 Syfilis, anden spec 01-01-1994 31-12-2011
DA539 Syfilis UNS 01-01-1994
DA54 Gonoré 01-01-1994
DA540 Gonokokinf, nedre urin- og kønsorganer u absces 01-01-1994
DA540A Gonoroisk cervicitis UNS 01-01-1994
DA540B Gonoroisk cystitis UNS 01-01-1994
DA540C Gonorrhoea genitalis 01-01-1994 31-12-2011
DA540D Gonoroisk uretritis UNS 01-01-1994
DA540E Gonoroisk vulvovaginitis UNS 01-01-1994
DA540F Gonoroisk balanopostitis 01-04-2000
DA541 Gonokokinf., nedre urin- og kønsorganer m periuretral absces 01-01-1994
DA541A Urogenital gonoroisk absces 01-01-1994
DA541B Gonoroisk bartholinitis 01-01-1994
DA542 Gonoroisk pelvioperitonitis/an. gonoroisk urogenital infek. 01-01-1994
DA542A Endometritis gonococcica 01-01-1994 31-12-2011
DA542B Oophoritis gonococcica 01-01-1994 31-12-2011
DA542C Parametritis gonococcica 01-01-1994 31-12-2011
DA543 Gonokokinfektion i øje 01-01-1994
DA543A Gonoroisk purulent konjunktivitis hos nyfødt 01-01-1994
DA544 Gonokokinfektion i led og muskler 01-01-1994
DA544A Arthritis gonorrhoica 01-01-1994 31-12-2011
DA544B Osteomyelitis gonococcica 01-01-1994 31-12-2011
DA544C Synovitis gonococcica 01-01-1994 31-12-2011
DA544D Tendovaginitis gonococcica 01-01-1994 31-12-2011
DA545 Gonokokinfektion i svælget 01-01-1994
DA546 Gonokokinfektion i anus og rektum 01-01-1994
DA546A Gonokokinfektion i anus 01-01-1994 31-12-2011
DA546B Gonokokinfektion i rectum 01-01-1994 31-12-2011
DA548 Anden gonokokinfektion 01-01-1994
DA548A Abscessus gonococcica cerebri 01-01-1994 31-12-2011
DA548B Gonoroisk dermatitis 01-01-1994
DA548C Endocarditis gonococcica 01-01-1994 31-12-2011
DA548D Meningitis, gonoroisk 01-01-1994 31-12-2011
DA548E Myocarditis, gonoroisk 01-01-1994 31-12-2011
DA548F Pneumonia gonococcica 01-01-1994 31-12-2011
DA548G Gonoroisk sepsis 01-01-1994
DA548H Dermatitis arthritis syndrom (gonoré) 01-04-2000 31-12-2011
DA549 Gonokokinfektion UNS 01-01-1994
DA55 Venerisk lymfogranulom forårsaget af klamydiainfektion 01-01-1994
DA559 Lymfogranulom forårsaget af Chlamydia 01-01-1994
DA56 Andre seksuelt overførte klamydiainfektioner 01-01-1994
DA560 Klamydiainfektion i nedre urin- og kønsorganer 01-01-1994
DA560A Klamydiacervicitis 01-01-1994
DA560B Chlamydia infektion i nedre urin- og kønsorganer 01-01-1994 31-12-2011
DA560C Klamydiacystitis 01-01-1994
DA560D Klamydiauretritis 01-01-1994
DA560E Vulvovaginitis forårsaget af klamydia 01-01-1994
DA561 Klamydiainfektion i nedre bækken el. an. urin- og kønsorgan 01-01-1994
DA561A Epididymitis Chlamydiae 01-01-1994 31-12-2011
DA561B Orchitis Chlamydiae 01-01-1994 31-12-2011
DA561C Parametritis Chlamydiae 01-01-1994 31-12-2011
DA562 Klamydiainfektion i urin- og kønsorganer UNS 01-01-1994
DA563 Klamydiainfektion i anus og rektum 01-01-1994
DA563A Infectio Chlamydiae ani 01-01-1994 31-12-2011
DA563B Infectio Chlamydiae recti 01-01-1994 31-12-2011
DA564 Klamydiainfektion i svælget 01-01-1994
DA568 Seksuelt overført klamydiainfektion med anden lokalisation 01-01-1994
DA568A Arthritis Chalmydiae 01-01-1994 31-12-2011
DA57 Blød chanker 01-01-1994
DA579 Ulcus molle UNS 01-01-1994
DA58 Granulom f.a. infektion med Calymmatobacterium granulomatis 01-01-1994
DA589 Granuloma inguinale UNS 01-01-1994
DA59 Infektioner med Trichomonas vaginalis 01-01-1994
DA590 Trichomoniasis i urin- og kønsorganer 01-01-1994
DA590A Vaginalt udflåd forårsaget af trichomonasis 01-01-1994
DA590B Trichomonas prostatitis 01-01-1994 31-12-2011
DA590C Trichomonasvaginitis 01-01-1994
DA598 Trichomoniasis med anden lokalisation 01-01-1994
DA599 Trichomoniasis UNS 01-01-1994
DA60 Herpes simplex-infektion i anogenitalregionen 01-01-1994
DA600 Herpes simplex-infektion i urin- og kønsorganer 01-01-1994
DA600A Herpes viralis genitalis feminae 01-01-1994 31-12-2011
DA600B Herpes viralis genitalis masculinae 01-01-1994 31-12-2011
DA601 Herpes simplex-infektion i analregion og endetarm 01-01-1994
DA601A Herpes simplex-infektion i anus 01-01-1994
DA601B Herpes simplex-infektion i perianalregionen 01-01-1994
DA601C Herpes simplex-infektion i rektum 01-01-1994
DA609 Herpes simplex-infektion i anogenitalregionen UNS 01-01-1994
DA63 An. fortrinsvis seksuelt overførte sygdomme, som ikke er KA 01-01-1994
DA630 Condyloma acuminatum i anogenitalregionen 01-01-1994
DA630A Condyloma acuminatum 01-01-1994 30-09-2007
DA630B Uretrale kondylomer 01-10-2007
DA630C Genitale kondylomer 01-10-2007
DA630D Anale kondylomer 01-10-2007
DA630E Ekstragenitale kondylomer 01-01-2020
DA638 Anden fortrinsvis seksuelt overført sygdom IKA 01-01-1994
DA638A Gardnerella infektion 01-04-2000
DA64 Seksuelt overført sygdom uden specificering 01-01-1994
DA649 Seksuelt overført sygdom UNS 01-01-1994
DA65 Ikke-venerisk syfilis 01-01-1994
DA659 Ikke-venerisk syfilis UNS 01-01-1994
DA66 Frambøsia 01-01-1994
DA660 Tidlig frambøsia 01-01-2012
DA661 Multiple frambøsia papillomer 01-01-2012
DA662 Andet tidligt hudsymptom ved frambøsia 01-01-2012
DA663 Hyperkeratose ved frambøsia 01-01-2012
DA664 Gumma og sår ved frambøsia 01-01-2012
DA665 Rhinopharyngitis mutilans ved frambøsia 01-01-2012
DA666 Knogle- og ledforandringer ved frambøsia 01-01-2012
DA667 Anden manifestation ved frambøsia 01-01-2012
DA668 Latent frambøsia 01-01-2012
DA669 Frambøsia UNS 01-01-1994
DA669A Framboesia 01-01-1994 31-12-2011
DA67 Pinta 01-01-1994
DA670 Primær manifestation ved pinta 01-01-2012
DA671 Sekundær manifestation ved pinta 01-01-2012
DA672 Sen manifestation ved pinta 01-01-2012
DA673 Blandede manifestationer ved pinta 01-01-2012
DA679 Pinta UNS 01-01-1994
DA68 Tilbagefaldsfeber 01-01-1994
DA680 Tilbagefaldsfeber overført af lus 01-01-1994
DA681 Tilbagefaldsfeber overført af flåt 01-01-1994
DA689 Tilbagefaldsfeber UNS 01-01-1994
DA69 Andre infektioner forårsaget af spirokæter 01-01-1994
DA690 Nekrotiserende ulcerøs mundbetændelse 01-01-1994
DA690A Cancrum oris 01-01-1994
DA690B Noma 01-01-1994
DA690C Stomatitis ulcerosa Vincent 01-01-1994
DA691 Anden Vincent-infektion 01-01-1994
DA691A Angina ulcerosa Vincent 01-01-1994
DA691B Faryngitis forårsaget af spirokæteinfektion 01-01-1994
DA691C Vincents angina 01-01-1994
DA691E Akut nekrotiserende ulcerøs stomatitis 01-01-1994
DA691F Vincents gingivitis 01-01-1994
DA691G Faryngitis forårsaget af fusospirokæteinfektion 01-01-1994
DA692 Lymes sygdom 01-01-1994
DA692A Kronisk atrofisk akrodermatit 01-01-1994
DA692B Borrelia arthritis 01-01-1994 31-12-2011
DA692C Borrelia carditis 01-01-1994 31-12-2011
DA692D Borrelia polyradikulitis 01-01-1994
DA692E Borreliosis 01-01-1994 31-12-2011
DA692F Erythema chronicum migrans 01-01-1994
DA692G Polyradiculitis ved Borrelia infektion 01-01-1994 31-12-2011
DA698 Anden spirokæteinfektion 01-01-1994
DA699 Spirokæteinfektion UNS 01-01-1994
DA70 Infektioner forårsaget af Chlamydophila psittaci 01-01-1994
DA709 Chlamydophila psittaci-infektion 01-01-1994
DA709A Ornithosis 01-01-1994 31-12-2011
DA709B Psittacosis 01-01-1994 31-12-2011
DA71 Ægyptisk øjensygdom 01-01-1994
DA710 Tidligt stadie af trakom 01-01-2012
DA711 Aktivt stadie af trakom 01-01-2012
DA719 Trakom UNS 01-01-1994
DA74 Andre sygdomme forårsaget af klamydia-bakterier 01-01-1994
DA740 Klamydiakonjunktivitis 01-01-1994
DA748 Anden klamydia-infektion 01-01-1994
DA748A Peritonitis Chlamydiae 01-01-1994 31-12-2011
DA749 Klamydia-infektion UNS 01-01-1994
DA75 Rickettsioser overført af lus, lopper og mider 01-01-1994
DA750 Plettyfus forårsaget af Rickettsia prowazekii 01-01-2012
DA751 Brill-Zinssers sygdom 01-01-2012
DA752 Plettyfus forårsaget af Rickettsia typhi 01-01-2012
DA753 Plettyfus forårsaget af Rickettsia tsutsugamushi 01-01-2012
DA759 Plettyfus UNS 01-01-1994
DA759A Rickettsiose overført af lus 01-01-1994 31-12-2011
DA759B Tsutsugamushi fever 01-01-1994 31-12-2011
DA77 Rickettsioser overført af flåt 01-01-1994
DA770 Rickettsiose forårsaget af Rickettsia rickettsii 01-01-2012
DA771 Rickettsiose forårsaget af Rickettsia conorii 01-01-2012
DA772 Rickettsiose forårsaget af Rickettsia sibirica 01-01-2012
DA773 Rickettsiose forårsaget af Rickettsia australis 01-01-2012
DA778 Anden rickettsiose overført af flåt 01-01-2012
DA779 Rickettsiose overført af flåt UNS 01-01-1994
DA78 Q-feber 01-01-1994
DA789 Q-feber UNS 01-01-1994
DA79 Andre rickettsioser 01-01-1994
DA790 Skyttegravsfeber 01-01-2012
DA791 Rickettsiose forårsaget af Rickettsia akari 01-01-2012
DA798 Anden rickettsiose 01-01-2012
DA798A Rickettsiose fa. Neorickettsia sennetsu [Ehrlichia sennetsu] 01-01-2012
DA798B Rickettsiose forårsaget af Ehrlichia phagocytophila 01-01-2015
DA799 Rickettsiose UNS 01-01-1994
DA80 Akut polio 01-01-1994
DA800 Akut polio med lammelser forårsaget af vaccine 01-01-1994
DA801 Akut polio med lammelser forårsaget af importeret vild virus 01-01-1994
DA802 Akut polio m. lammelser forårsaget af indenlandsk vild virus 01-01-1994
DA803 Anden eller ikke specificeret akut polio med lammelser 01-01-1994
DA804 Akut polio uden lammelser 01-01-1994
DA809 Akut polio UNS 01-01-1994
DA81 Atypiske virusinfektioner i centralnervesystemet 01-01-1994
DA810 Creutzfeldt-Jakobs sygdom 01-01-1994
DA811 Subakut skleroserende panencephalitis 01-01-1994
DA812 Progressiv multifokal leukoencefalopati 01-01-1994
DA818 Anden atypisk virusinfektion i centralnervesystemet 01-01-1994
DA818A Kuru 01-01-1994
DA818B Fatal familiær insomni 01-04-2006
DA819 Atypisk virusinfektion i centralnervesystemet UNS 01-01-1994
DA819A Prionsygdom i centralnervesystemet UNS 01-01-2012
DA82 Hundegalskab 01-01-1994
DA820 Sylvatisk rabies (lyssavirus type 1) 01-01-2012
DA821 Flagermusrabies (European Bat Lyssavirus - EBL) 01-01-2012
DA829 Rabies UNS 01-01-1994
DA83 Viral hjernebetændelse overført af myg 01-01-1994
DA830 Japansk hjernebetændelse 01-01-1994
DA831 Encephalomyelitis equina occidentalis 01-01-2012
DA832 Encephalomyelitis equina orientalis 01-01-2012
DA833 St Louis-encephalitis 01-01-2012
DA834 Australsk encephalitis 01-01-2012
DA835 Californisk encephalitis 01-01-2012
DA836 Rocio virus-encephalitis 01-01-2012
DA838 Anden viral hjernebetændelse overført af myg 01-01-1994
DA839 Viral hjernebetændelse overført af myg UNS 01-01-1994
DA84 Viral hjernebetændelse overført af flåt 01-01-1994
DA840 Encephalitis viralis occidentalis 01-01-1994
DA840A Meningoencephalitis viralis per ixodidam 01-01-1994 31-12-2011
DA841 Centraleuropæisk viral encephalitis overført af flåt 01-01-1994
DA848 Anden viral hjernebetændelse overført af flåt 01-01-1994
DA849 Viral hjernebetændelse overført af flåt UNS 01-01-1994
DA85 Viral hjernebetændelse IKA 01-01-1994
DA850 Hjernebetændelse forårsaget af enterovirus 01-01-1994
DA850A Encephalomyelitis enteroviralis 01-01-1994 31-12-2011
DA851 Hjernebetændelse forårsaget af adenovirus 01-01-1994
DA851A Encephalomyelitis adenoviralis 01-01-1994 31-12-2011
DA851B Meningoencephalitis adenoviralis 01-01-1994 31-12-2011
DA852 Viral hjernebetændelse overført af leddyr UNS 01-01-1994
DA858 Anden viral hjernebetændelse 01-01-1994
DA858A Encephalitis lethargica 01-01-1994
DA858B Encephalitis lethargica 01-01-1994 31-12-2011
DA86 Viral hjernebetændelse UNS 01-01-1994
DA869 Viral encephalitis UNS 01-01-1994
DA87 Viral hjernehindebetændelse IKA 01-01-1994
DA870 Meningitis forårsaget af enterovirus 01-01-1994
DA870A Meningitis forårsaget af coxsackievirus 01-01-1994
DA870B Meningitis forårsaget af echovirus 01-01-1994
DA871 Meningitis forårsaget af adenovirus 01-01-1994
DA872 Lymfocytær koriomeningitis 01-01-1994
DA872A Lymfocytær meningoencephalitis 01-01-1994
DA878 Anden viral hjernehindebetændelse 01-01-1994
DA879 Viral hjernehindebetændelse UNS 01-01-1994
DA88 Andre virale infektioner i centralnervesystemet IKA 01-01-1994
DA880 Febris enteroviralis exanthematica 01-01-1994
DA881 Vertigo epidemica 01-01-1994
DA888 Anden viral infektion i centralnervesystemet IKA 01-01-1994
DA89 Virale infektioner i centralnervesystemet UNS 01-01-1994
DA899 Viral infektion i centralnervesystemet UNS 01-01-1994
DA90 Denguefeber 01-01-1994 31-12-2015
DA909 Denguefeber UNS 01-01-1994 31-12-2015
DA91 Denguefeber med blødninger 01-01-1994 31-12-2015
DA919 Hæmoragisk denguefeber 01-01-1994 31-12-2015
DA92 Andre virale febersygdomme overført af myg 01-01-1994
DA920 Chikungunya virussygdom 01-01-2012
DA921 O'nyong-nyong-feber 01-01-2012
DA922 Venezuelansk ekvin encephalitis 01-04-2003
DA923 West Nile feber 01-01-2012
DA924 Rift Valley-feber 01-01-2012
DA925 Zika virussygdom 01-04-2021
DA928 Anden viral febersygdom overført af myg 01-01-2012
DA928A Zika virussygdom 21-12-2015 31-03-2021
DA929 Viral febersygdom overført af myg UNS 01-01-1994
DA93 Andre virale febersygdomme overført af leddyr IKA 01-01-1994
DA930 Oropouche virussygdom 01-01-2012
DA931 Sandfluefeber 01-01-1994
DA932 Colorado flåtfeber 01-01-2012
DA938 Anden viral febersygdom overført af leddyr 01-01-1994
DA94 Viral febersygdom overført af leddyr UNS 01-01-1994
DA949 Viral febersygdom overført af leddyr UNS 01-01-1994
DA95 Gul feber 01-01-1994
DA950 Sylvatisk gul feber 01-01-2012
DA951 Urban gul feber 01-01-2012
DA959 Gul feber UNS 01-01-1994
DA96 Arenavirale febersygdomme med blødninger 01-01-1994
DA960 Junin hæmoragisk feber 01-01-2012
DA961 Machupo hæmoragisk feber 01-01-2012
DA962 Lassafeber 01-01-1994
DA968 Anden arenaviral febersygdom med blødninger 01-01-1994
DA969 Arenaviral feber med blødninger UNS 01-01-1994
DA97 Dengue 01-01-2016
DA970 Dengue uden advarselstegn 01-01-2016
DA971 Dengue med advarselstegn 01-01-2016
DA972 Alvorlig Dengue 01-01-2016
DA979 Dengue UNS 01-01-2016
DA98 Andre virale febersygdomme med blødninger 01-01-1994
DA980 Krim-Congo hæmoragisk feber 01-04-2003
DA981 Omsk hæmoragisk feber 01-01-2012
DA982 Kyasanurfeber 01-01-2012
DA983 Marburgfeber 01-01-1994
DA984 Ebolavirus-sygdom 01-01-1994
DA985 Hæmoragisk feber med renalt syndrom 01-01-1994
DA985A Epidemisk hæmoragisk feber 01-01-1994
DA985B Hantavirus-sygdom 01-01-1994
DA985C Epidemisk nefropati 01-01-1994
DA988 Anden viral febersygdom med blødninger 01-01-1994
DA99 Virale febersygdomme med blødninger UNS 01-01-1994
DA999 Viral febersygdom med blødninger UNS 01-01-1994
DB00 Herpes simplex-infektion 01-01-1994
DB000 Herpeseksem 01-01-1994
DB000A Eruptio varicelliformis Kaposi 01-01-1994 31-12-2011
DB001 Herpesudbrud med blærer 01-01-1994
DB001A Herpes facialis 01-01-1994
DB001B Herpes labialis 01-01-1994
DB001C Ekstern otitis forårsaget af Herpes simplex-virus 01-01-2012
DB002 Gingivostomatitis/faryngotonsillit f.a. Herpes simplex-virus 01-01-1994
DB002A Gingivostomatitis forårsaget af Herpes simplex-virus 01-01-1994
DB002B Faryngotonsillitis forårsaget af Herpes simplex-virus 01-01-1994
DB002C Faryngitis forårsaget af Herpes simplex-virus 01-01-2012
DB003 Meningitis forårsaget af Herpes simplex-virus 01-01-1994
DB004 Encephalitis forårsaget af Herpes simplex-virus 01-01-1994
DB004A Meningoencephalitis forårsaget af Herpes simplex-virus 01-01-1994
DB005 Herpes simplex-infektion i øje 01-01-1994
DB005A Blepharitis herpetica 01-01-1994 31-12-2011
DB005B Herpes conjunctivitis 01-01-1994 31-12-2011
DB005C Herpes iridocyclitis 01-01-1994 31-12-2011
DB005D Herpes keratitis 01-01-1994 31-12-2011
DB005E Herpes keratoconjunctivitis 01-01-1994 31-12-2011
DB005F Iritis herpetica 01-01-1994 31-12-2011
DB005G Uveitis anterior herpetica 01-01-1994 31-12-2011
DB007 Herpes generalisata 01-01-1994
DB008 Anden form for Herpes simplex-virus infektion 01-01-1994
DB009 Infektion med Herpes simplex-virus UNS 01-01-1994
DB01 Skoldkopper 01-01-1994
DB010 Meningitis forårsaget af Varicella zoster 01-01-1994
DB011 Encephalitis forårsaget af Varicella zoster 01-01-1994
DB011A Encephalomyelitis forårsaget af Varicella zoster 01-01-1994
DB012 Pneumoni forårsaget af Varicella zoster 01-01-1994
DB018 Skoldkopper med anden komplikation 01-01-1994
DB019 Skoldkopper UNS 01-01-1994
DB02 Zoster 01-01-1994
DB020 Herpes zoster-encephalitis 01-01-1994
DB020A Herpes zoster-meningoencephalitis 01-01-1994
DB021 Herpes zoster-meningitis 01-01-1994
DB022 Herpes zoster med anden komplikation i nervesystemet 01-01-1994
DB022A Herpes zoster neuralgia nervi trigemini 01-01-1994 31-12-2011
DB022B Herpes zoster polyneuritis 01-01-1994 31-12-2011
DB023 Herpes zoster i øje 01-01-1994
DB023A Herpes zoster blepharitis 01-01-1994 31-12-2011
DB023B Herpes zoster conjunctivitis 01-01-1994 31-12-2011
DB023C Herpes zoster iridocyclitis 01-01-1994 31-12-2011
DB023D Herpes zoster iritis 01-01-1994 31-12-2011
DB023E Herpes zoster keratitis 01-01-1994 31-12-2011
DB023F Herpes zoster keratoconjunctivitis 01-01-1994 31-12-2011
DB023G Herpes zoster scleritis 01-01-1994 31-12-2011
DB027 Dissemineret herpes zoster 01-01-1994
DB028 Herpes zoster-infektion med anden komplikation 01-01-1994
DB029 Herpes zoster-infektion uden komplikation 01-01-1994
DB03 Kopper 01-01-1994
DB039 Kopper UNS 01-01-1994
DB04 Abekopper (monkeypox) 01-01-1994
DB049 Abekopper (monkeypox) UNS 01-01-1994
DB05 Mæslinger 01-01-1994
DB050 Mæslinger kompliceret med encephalitis 01-01-1994
DB051 Mæslinger kompliceret med meningitis 01-01-1994
DB052 Mæslinger kompliceret med pneumoni 01-01-1994
DB053 Mæslinger kompliceret med mellemørebetændelse 01-01-1994
DB054 Mæslinger med tarmkomplikation 01-01-1994
DB058 Mæslinger med anden komplikation 01-01-1994
DB058A Keratitis ved morbilli 01-01-1994 31-12-2011
DB058B Keratoconjunctivitis ved morbilli 01-01-1994 31-12-2011
DB059 Mæslinger uden komplikationer 01-01-1994
DB06 Røde hunde 01-01-1994
DB060 Røde hunde med neurologisk komplikation 01-01-1994
DB060A Rubella encephalitis 01-01-1994 31-12-2011
DB060B Rubella meningitis 01-01-1994 31-12-2011
DB060C Rubella meningoencephalitis 01-01-1994 31-12-2011
DB068 Røde hunde med anden komplikation 01-01-1994
DB068A Rubella pneumonia 01-01-1994 31-12-2011
DB069 Røde hunde uden komplikationer 01-01-1994
DB07 Virale vorter 01-01-1994
DB079 Verrucae virales UNS 01-01-1994
DB079A Verruca plana juvenilis 01-01-1994
DB079B Verrucae vulgaris 01-01-1994 31-12-2011
DB079C Verruca plantaris 01-04-2000
DB079D Epidermodysplasia verruciformis 01-04-2000
DB08 An. virussygdomme karak.v. hud- og slimhindeaffektion IKA 01-01-1994
DB080 Anden poxvirusinfektion 01-01-1994
DB080A Milkers nodule 01-04-2000
DB080B Orf 01-04-2000
DB081 Molluscum contagiosum 01-01-1994
DB082 Tredagesfeber 01-01-1994
DB083 Lussingesyge 01-01-1994
DB084 Hånd-, fod- og mundsygdom 01-01-1994
DB084A Stomatitis vesicularis enteroviralis med exanthem 01-01-1994 31-12-2011
DB085 Herpangina 01-01-1994
DB088 Anden virussygdom med hud- og slimhindeaffektion 01-01-1994
DB088A Mund- og klovsyge 01-01-1994
DB088B Pharyngitis enteroviralis lymphonodularis 01-01-1994
DB088C Viralt eksantem 01-04-2000 31-12-2011
DB088D Yersinia eksantem 01-04-2000 05-05-2000
DB09 Virussygdomme UNS karak.v. hud- og slimhindeaffektioner 01-01-1994
DB099 Virusinfektion karak.v hud- og slimhindeaffektion UNS 01-01-1994
DB099A Viralt eksantem UNS 01-01-2012
DB15 Akut hepatitis A 01-01-1994
DB150 Hepatitis A med leverkoma 01-01-1994
DB159 Hepatitis A uden leverkoma 01-01-1994
DB159A Hepatitis A UNS 01-07-2006
DB16 Akut hepatitis B 01-01-1994
DB160 Akut hepatitis B m. coinfektion m. Delta agens m. leverkoma 01-01-1994
DB161 Akut hepatitis B m. coinfektion m. Delta agens u. leverkoma 01-01-1994
DB162 Akut hepatitis B u. coinfektion m. Delta agens m. leverkoma 01-01-1994
DB169 Akut hepatit B u coinfektion m Delta agens og uden leverkoma 01-01-1994
DB169A Hepatitis B UNS 01-01-2012
DB17 Anden akut viral leverbetændelse 01-01-1994
DB170 Akut Delta-superinfektion i kronisk hepatitis B 01-01-1994
DB171 Akut hepatitis C 01-01-1994
DB172 Akut hepatitis E 01-01-1994
DB178 Anden akut viral hepatitis 01-01-1994
DB179 Akut viral hepatitis UNS 01-01-2013
DB18 Kronisk viral leverbetændelse 01-01-1994
DB180 Kronisk viral hepatitis B med Delta agens 01-01-1994
DB181 Kronisk viral hepatitis B uden Delta agens 01-01-1994
DB182 Kronisk viral hepatitis C 01-01-1994
DB188 Anden kronisk viral hepatitis 01-01-1994
DB189 Kronisk viral hepatitis UNS 01-01-1994
DB19 Viral leverbetændelse uden specificering 01-01-1994
DB190 Viral hepatitis UNS med leverkoma 01-01-1994
DB199 Viral hepatitis UNS uden leverkoma 01-01-1994
DB20 HIV-sygdom medførende infektiøse og parasitære sygdom 01-01-1994
DB200 HIV-sygdom med mykobakteriel infektion 01-01-1994
DB200A HIV-sygdom med tuberkulose 01-01-1994
DB201 HIV-sygdom med andre bakterielle sygdomme 01-01-1994
DB202 HIV-sygdom med cytomegalovirus sygdom 01-01-1994
DB203 HIV-sygdom med andre virus infektioner 01-01-1994
DB204 HIV-sygdom med candidiasis 01-01-1994
DB205 HIV-sygdom med andre svampeinfektioner 01-01-1994
DB206 HIV-sygdom med Pneumocystis jirovecii pneumoni 01-01-1994
DB207 HIV-sygdom med multiple infektioner 01-01-1994
DB208 HIV-sygdom med andre infektiøse og parasitære sygdomme 01-01-1994
DB209 HIV-sygdom med infektiøs eller parasitær sygdom UNS 01-01-1994
DB21 Humant immundefekt-virus (HIV) sygdom med neoplastisk sygdom 01-01-1994 31-03-2019
DB210 HIV-sygdom med Kaposi's sarkom 01-01-1994 31-03-2019
DB210A HIV-infektion med Kaposi sarkom 01-01-1994 31-12-2011
DB211 HIV-sygdom med Burkitt's lymfom 01-01-1994 31-03-2019
DB212 HIV-sygdom med andet non-Hodgkin's lymfom 01-01-1994 31-03-2019
DB213 HIV-sygdom med anden neoplasi i lymfoidt og bloddannende væv 01-01-1994 31-03-2019
DB217 HIV-sygdom med multiple neoplasier 01-01-1994 31-03-2019
DB218 HIV-sygdom med anden neoplasi 01-01-1994 31-03-2019
DB219 HIV sygdom med neoplasi UNS 01-01-1994 31-03-2019
DB22 HIV sygdom med andre specificerede sygdomme 01-01-1994
DB220 HIV-encefalopati 01-01-1994
DB220A HIV-demens 01-01-1994
DB221 HIV-lymfoid interstitiel pneumonitis 01-01-1994
DB222 HIV-wasting syndrome 01-01-1994
DB227 HIV-sygdom med multiple sygdomme klassificeret andetsteds 01-01-1994
DB23 Andre tilstande ved HIV-sygdom 01-01-1994
DB230 Akut HIV-sygdom 01-01-1994
DB231 HIV-sygdom med (persisterende) generaliseret lymfadenopati 01-01-1994
DB232 HIV-sygdom med hæmatologiske og immunologiske forandr. IKA 01-01-1994
DB238 Anden eller ikke specificeret symptomatisk HIV-sygdom 01-01-1994
DB238A HIV-associeret lipodystrofisyndrom (HALS) 01-01-2010
DB24 HIV-sygdom og AIDS uden specificering 01-01-1994
DB240 HIV infektion, uden symptomer 01-04-2000 31-03-2004
DB249 AIDS UNS 01-01-1994
DB25 Cytomegalovirale sygdomme 01-01-1994
DB250 Cytomegalovirus-pneumoni 01-01-1994
DB251 Cytomegalovirus-hepatitis 01-01-1994
DB252 Cytomegalovirus-pankreatitis 01-01-1994
DB253 Chorioretinitis cytomegaloviralis 01-01-1994 31-12-2011
DB257 Retinitis cytomegaloviralis 01-01-1994 31-12-2011
DB258 Anden sygdom forårsaget af cytomegalovirus 01-01-1994
DB259 Cytomegaloviral sygdom UNS 01-01-1994
DB26 Fåresyge 01-01-1994
DB260 Fåresygeorkitis 01-01-1994
DB261 Fåresygemeningitis 01-01-1994
DB262 Fåresygeencephalitis 01-01-1994
DB263 Fåresygepankreatitis 01-01-1994
DB268 Fåresyge med anden komplikation 01-01-1994
DB269 Fåresyge uden komplikationer 01-01-1994
DB27 Mononukleose 01-01-1994
DB270 Mononukleose forårsaget af Epstein-Barr virus 01-01-1994
DB271 Mononukleose forårsaget af cytomegalovirus 01-01-1994
DB278 Anden infektiøs mononukleose 01-01-1994
DB279 Mononukleose UNS 01-01-1994
DB30 Viral konjunktivitis 01-01-1994
DB300 Keratokonjunktivitis forårsaget af adenovirus 01-01-1994
DB301 Konjunktivitis forårsaget af adenovirus 01-01-1994
DB301A Akut follikulær konjunktivitis forårsaget af adenovirus 01-01-1994
DB301B Svømmebassin-konjunktivitis 01-01-1994
DB302 Viral faryngokonjunktivitis 01-01-1994
DB303 Akut epidemisk hæmoragisk konjunktivitis 01-01-1994
DB303A Konjunktivitis forårsaget af coxsackievirus type 24 01-01-1994
DB303B Konjunktivitis forårsaget af enterovirus type 70 01-01-1994
DB303C Akut hæmoragisk konjunktivitis UNS 01-01-2012
DB308 Anden viral konjunktivitis 01-01-1994
DB308A Konjunktivitis forårsaget af Newcastle-virus 01-01-2012
DB309 Viral konjunktivitis UNS 01-01-1994
DB33 Andre virussygdomme IKA 01-01-1994
DB330 Epidemisk myalgi 01-01-1994
DB331 Ross River-sygdom 01-01-1994
DB332 Viruskarditis 01-01-1994
DB333 Retrovirus-infektion IKA 01-01-1994
DB334 Hantavirus med (kardio-)pulmonalt syndrom 01-01-2012
DB338 Anden virussygdom 01-01-1994
DB34 Virussygdom uden angivelse af lokalisation 01-01-1994
DB340 Adenovirus-infektion uden angivelse af lokalisation 01-01-1994
DB341 Enterovirus-infektion uden angivelse af lokalisation 01-01-1994
DB341A Coxsackievirus-infektion UNS 01-01-1994
DB341B Echovirus-infektion UNS 01-01-1994
DB342 Coronavirus-infektion uden angivelse af lokalisation 01-01-1994
DB342A COVID-19-infektion uden angivelse af lokalisation 01-12-2019
DB343 Parvovirus-infektion uden angivelse af lokalisation 01-01-1994
DB344 Papovavirus-infektion uden angivelse af lokalisation 01-01-1994
DB348 Anden virusinfektion uden angivelse af lokalisation 01-01-1994
DB349 Virusinfektion UNS 01-01-1994
DB349A Viræmi UNS 01-01-1996
DB35 Hudsvamp 01-01-1994
DB350 Svampesygdom i hovedbunden eller skægregionen 01-01-1994
DB350A Tinea capitis 01-01-1994
DB350B Tinea barbae 01-01-1994
DB350C Kerion 01-04-2000
DB351 Neglesvamp 01-01-1994
DB352 Håndsvamp 01-01-1994
DB353 Fodsvamp 01-01-1994
DB354 Svampesygdom på kroppen 01-01-1994
DB354A Dermatophytosis perigenitalis 01-01-2012
DB355 Tinea imbricata 01-01-1994
DB356 Svampesygdom på benet 01-01-1994
DB356A Tinea cruris 01-01-1994 31-12-2011
DB356B Dermatophytosis inguinalis 01-01-2012
DB358 Anden form for dermatofytose 01-01-1994
DB358A Dermatophytosis disseminata 01-01-1994
DB358B Favus 01-04-2000
DB359 Dermatofytose UNS 01-01-1994
DB36 Andre overfladiske svampeinfektioner 01-01-1994
DB360 Pityriasis versicolor 01-01-1994
DB360A Tinea flava 01-01-1994 31-12-2011
DB360B Tinea versicolor 01-01-1994 31-12-2011
DB361 Tinea nigra 01-01-1994
DB362 Hvid piedra 01-01-1994
DB363 Sort piedra 01-01-1994
DB368 Anden overfladisk svampeinfektion 01-01-1994
DB368A Pityrosporum folliculitis 01-04-2000
DB369 Overfladisk svampeinfektion UNS 01-01-1994
DB37 Infektion med Candida albicans 01-01-1994
DB370 Candidiasis i mundhule 01-01-1994
DB370A Trøske 01-01-1994
DB371 Candidiasis i lunge 01-01-1994
DB372 Candidiasis i hud og negle 01-01-1994
DB372A Candidiasis cutis 01-01-1994
DB372B Candidiasis unguinis 01-01-1994
DB372C Erosio interdigitalis blastomycetica 01-04-2000 31-12-2011
DB373 Candidiasis i vulva og vagina 01-01-1994
DB373A Candidiasis-vaginitis 01-01-1994
DB373B Candidiasis-vulvitis 01-01-1994
DB373C Candidiasis-vulvovaginitis 01-01-2012
DB374 Urogenital candidiasis med anden lokalisation 01-01-1994
DB374A Candidiasis urethrae 01-01-1994 31-12-2011
DB375 Candidiasis-meningitis 01-01-1994
DB376 Candidiasis-endokarditis 01-01-1994
DB377 Candidiasis-sepsis 01-01-1994
DB378 Candidiasis med anden lokalisation 01-01-1994
DB378A Candidiasis-keilitis 01-01-1994
DB378B Candidiasis-enteritis 01-01-1994
DB378C Candidiasis-øsofagitis 01-01-1994
DB379 Candidiasis UNS 01-01-1994
DB38 Coccidioidomykose 01-01-1994
DB380 Akut pulmonal coccidioidomykose 01-01-2012
DB381 Kronisk pulmonal coccidioidomykose 01-01-2012
DB382 Pulmonal coccidioidomykose UNS 01-01-2012
DB383 Kutan coccidioidomykose 01-01-2012
DB384 Coccidioido-meningitis 01-01-2012
DB387 Dissemineret coccidioidomykose 01-01-2012
DB388 Anden form for coccidioidomykose 01-01-2012
DB389 Coccidioidomykose UNS 01-01-1994
DB39 Histoplasmose 01-01-1994
DB390 Akut pulmonal Histoplasmosis capsulati 01-01-2012
DB391 Kronisk pulmonal Histoplasmosis capsulati 01-01-2012
DB392 Pulmonal Histoplasmosis capsulati UNS 01-01-2012
DB393 Dissemineret Histoplasmosis capsulati 01-01-2012
DB394 Histoplasmosis capsulati UNS 01-01-2012
DB395 Histoplasmosis duboisii 01-01-2012
DB399 Histoplasmose UNS 01-01-1994
DB40 Blastomykose 01-01-1994
DB400 Akut pulmonal blastomykose 01-01-2012
DB401 Kronisk pulmonal blastomykose 01-01-2012
DB402 Pulmonal blastomykose UNS 01-01-2012
DB403 Kutan blastomykose 01-01-2012
DB407 Dissemineret blastomykose 01-01-2012
DB408 Anden form for blastomykose 01-01-2012
DB409 Blastomykose UNS 01-01-1994
DB41 Paracoccidioidomykose 01-01-1994
DB410 Pulmonal paracoccidioidomykose 01-01-2012
DB411 Dissemineret paracoccidioidomykose 01-01-2012
DB418 Anden form for paracoccidioidomykose 01-01-2012
DB419 Paracoccidioidomykose UNS 01-01-1994
DB42 Sporotrikose 01-01-1994
DB420 Pulmonal sporotrikose 01-01-2012
DB421 Lymfokutan sporotrikose 01-01-2012
DB427 Dissemineret sporotrikose 01-01-2012
DB428 Anden form for sporotrikose 01-01-2012
DB429 Sporotrikose UNS 01-01-1994
DB43 Kromomykose og fæomykotisk absces 01-01-1994
DB430 Kutan kromomykose 01-01-2012
DB431 Fæomykotisk hjerneabsces 01-01-2012
DB432 Subkutan fæomykotisk absces 01-01-2012
DB438 Anden form for kromomykose 01-01-2012
DB439 Kromomykose UNS 01-01-1994
DB439A Abscessus phaeomycoticus 01-01-1994 31-12-2011
DB44 Aspergillose 01-01-1994
DB440 Invasiv pulmonal aspergillose 01-01-1994
DB441 Anden pulmonal aspergillose 01-01-1994
DB441A Pulmonalt aspergillom 01-04-2006
DB441B Trakeobronkial aspergillose 01-04-2006
DB442 Tonsillær aspergillose 01-01-1994
DB447 Dissemineret aspergillose 01-01-1994
DB448 Anden form for aspergillose 01-01-1994
DB448A Kolonisering med aspergillus 01-04-2006
DB448B Ekstern otitis ved aspergillose 01-01-2012
DB449 Aspergillosis UNS 01-01-1994
DB45 Kryptokokkose 01-01-1994
DB450 Pulmonal kryptokokkose 01-01-1994
DB451 Cerebral kryptokokkose 01-01-1994
DB451A Meningitis cryptococcica 01-01-1994 31-12-2011
DB451B Meningocerebral kryptokokkose 01-01-2012
DB452 Kutan kryptokokkose 01-01-1994
DB453 Ossøs kryptokokkose 01-01-1994
DB457 Dissemineret kryptokokkose 01-01-1994
DB458 Anden form for kryptokokkose 01-01-1994
DB459 Kryptokokkose UNS 01-01-1994
DB46 Zygomykose 01-01-1994
DB460 Pulmonal mukormykose 01-01-2012
DB461 Rinocerebral mukormykose 01-01-2012
DB462 Gastrointestinal mukormykose 01-01-2012
DB463 Kutan mukormykose 01-01-2012
DB463A Subkutan mukormykose 01-01-2012
DB464 Dissemineret mukormykose 01-01-2012
DB465 Mukormykose UNS 01-01-2012
DB468 Anden form for zygomykose 01-01-2012
DB468A Entomophthoromykose 01-01-2012
DB469 Zygomykose UNS 01-01-1994
DB469A Mucormycosis 01-01-1994 31-12-2011
DB469B Fykomykose UNS 01-01-1994
DB469C Zygomycosis 01-01-1994 31-12-2011
DB47 Mycetoma 01-01-1994
DB470 Eumycetom 01-01-1994
DB471 Aktinomycetom 01-01-1994
DB479 Mycetoma UNS 01-01-1994
DB48 Andre mykoser IKA 01-01-1994
DB480 Lobomykose 01-01-1994
DB481 Rinosporidiose 01-01-1994
DB482 Allescheriasis 01-01-1994
DB483 Geotrikose 01-01-1994
DB484 Penicillose 01-01-1994
DB485 Pneumocystose 01-01-2019
DB487 Opportunistisk mykose 01-01-1994
DB488 Anden mykose 01-01-1994
DB49 Ikke specificerede mykoser 01-01-1994
DB499 Mykose UNS 01-01-1994
DB499A Fungæmi UNS 01-01-1996
DB50 Plasmodium falciparum-malaria 01-01-1994
DB500 Plasmodium falciparum-malaria med cerebrale komplikationer 01-01-2012
DB500A Cerebral malaria UNS 01-01-2012
DB508 Anden alvorlig eller kompl. Plasmodium falciparum-malaria 01-01-2012
DB509 Plasmodium falciparum-malaria uden komplikationer 01-01-1994
DB51 Plasmodium vivax-malaria 01-01-1994
DB510 Plasmodium vivax-malaria med miltruptur 01-01-2012
DB518 Plasmodium vivax-malaria med anden komplikation 01-01-2012
DB519 Plasmodium vivax-malaria uden komplikationer 01-01-1994
DB52 Plasmodium malariae-malaria 01-01-1994
DB520 Plasmodium malariae-malaria med nefropati 01-01-2012
DB528 Plasmodium malariae-malaria med anden komplikation 01-01-2012
DB529 Plasmodium malariae-malaria uden komplikationer 01-01-1994
DB53 Anden parasitologisk verificeret malaria 01-01-1994
DB530 Plasmodium ovale-malaria 01-01-1994
DB531 Malaria forårsaget af abe-plasmodier 01-01-2012
DB538 Anden parasitologisk verificeret malaria IKA 01-01-1994
DB538A Parasitologisk verificeret malaria UNS 01-01-2012
DB54 Malaria uden specificering 01-01-1994
DB549 Klinisk malaria, ikke parasitologisk verificeret 01-01-1994
DB55 Leishmaniasis 01-01-1994
DB550 Visceral leishmaniasis 01-01-1994
DB550A Kala-azar 01-01-1994 31-12-2011
DB551 Kutan leishmaniasis 01-01-1994
DB552 Mukokutan leishmaniasis 01-01-1994
DB559 Leishmaniasis UNS 01-01-1994
DB56 Afrikansk sovesyge 01-01-1994
DB560 Vestafrikansk sovesyge 01-01-1994
DB561 Østafrikansk sovesyge 01-01-1994
DB569 Afrikansk sovesyge UNS 01-01-1994
DB57 Chagas' sygdom 01-01-1994
DB570 Akut Chagas' sygdom med hjertekomplikationer 01-01-2012
DB571 Akut Chagas' sygdom uden hjertekomplikationer 01-01-2012
DB572 Kronisk Chagas' sygdom med hjertekomplikationer 01-01-2012
DB572A Trypanosomiasis UNS i område, hvor Chagas' sygdom forekommer 01-01-2012
DB573 Kronisk Chagas' sygdom med gastrointestinale komplikationer 01-01-2012
DB574 Chagas' sygdom med neurologiske komplikationer 01-01-2012
DB575 Chagas' sygdom med anden komplikation 01-01-2012
DB579 Chagas' sygdom UNS 01-01-1994
DB579A Trypanosomiasis americana 01-01-1994 31-12-2011
DB58 Toksoplasmose 01-01-1994
DB580 Toksoplasmose i øje 01-01-1994
DB581 Hepatitis ved toksoplasmose 01-01-1994
DB582 Meningoencephalitis ved toksoplasmose 01-01-1994
DB582A Toxoplasmosis cerebri 01-01-1994 31-12-2011
DB582B Toxoplasmosis meningum 01-01-1994 31-12-2011
DB583 Pulmonal toksoplasmose 01-01-1994
DB588 Toksoplasmose med anden lokalisation IKA 01-01-1994
DB588A Myocarditis toxoplasmotica 01-01-1994 31-12-2011
DB588B Myositis toxoplasmotica 01-01-1994 31-12-2011
DB589 Toksoplasmose UNS 01-01-1994
DB59 Pneumocystose 01-01-1994 31-12-2018
DB599 Pneumocystose UNS 01-01-1994 31-12-2018
DB60 Andre sygdomme forårsaget af protozoer IKA 01-01-1994
DB600 Babesiose 01-01-1994
DB600A Piroplasmose 01-01-1994
DB601 Acanthamoebiasis 01-01-1994
DB601A Conjunctivitis, Acanthamoeba 01-01-1994 31-12-2011
DB601B Keratoconjunctivitis, Acanthamoeba 01-01-1994 31-12-2011
DB602 Naegleriasis 01-01-1994
DB608 Anden sygdom forårsaget af protozoer 01-01-1994
DB608A Mikrosporidiose 01-01-1994
DB64 Sygdomme forårsaget af protozoer UNS 01-01-1994
DB649 Sygdom forårsaget af protozoer UNS 01-01-1994
DB65 Skistosomiasis 01-01-1994
DB650 Skistosomiasis forårsaget af Schistosoma haematobium 01-01-1994
DB651 Skistosomiasis forårsaget af Schistosoma mansoni 01-01-1994
DB652 Skistosomiasis forårsaget af Schistosoma japonicum 01-01-1994
DB653 Dermatitis cercaria 01-01-2012
DB656 Dermatitis cercaria 01-01-1994 31-12-2011
DB658 Anden type skistosomiasis 01-01-1994
DB659 Skistosomiasis UNS 01-01-1994
DB66 Andre ikte-infektioner 01-01-1994
DB660 Opisthorchiasis 01-01-1994
DB661 Clonorchiasis 01-01-1994
DB662 Dicrocoeliasis 01-01-1994
DB663 Fascioliasis 01-01-1994
DB664 Paragonimiasis 01-01-1994
DB665 Fasciolopsiasis 01-01-1994
DB668 Anden ikte-infektion 01-01-1994
DB669 Ikte-infektion UNS 01-01-1994
DB67 Ekinokokkose 01-01-1994
DB670 Infektion med Echinococcus granulosus i leveren 01-01-1994
DB671 Infektion med Echinococcus granulosus i lunge 01-01-1994
DB672 Infektion med Echinococcus granulosus i knogle 01-01-1994
DB673 Infektion med Echinococcus granulosus med anden/mult. lokal. 01-01-1994
DB674 Infektion med Echinococcus granulosus UNS 01-01-1994
DB675 Infektion med Echinococcus multilocularis i leveren 01-01-1994
DB676 Inf.m Echinococcus multilocularis an/multiple lokalisation. 01-01-1994
DB677 Infektion med Echinococcus multilocularis UNS 01-01-1994
DB678 Ekinokokinfektion i leveren UNS 01-01-1994
DB679 Anden eller ikke specificeret ekinokokinfektion 01-01-1994
DB68 Infektion med bændelorm 01-01-1994
DB680 Taeniasis forårsaget af Taenia solium 01-01-1994
DB681 Taeniasis forårsaget af Taenia saginata 01-01-1994
DB689 Taeniasis UNS 01-01-1994
DB69 Cysticerkose 01-01-1994
DB690 Cysticerkose i centralnervesystemet 01-01-2012
DB691 Cysticerkose i øje 01-01-2012
DB698 Cysticerkose med anden lokalisation 01-01-2012
DB699 Cysticerkose UNS 01-01-1994
DB70 Diphyllobothriasis og sparganosis 01-01-1994
DB700 Diphyllobothriasis 01-01-1994
DB701 Sparganosis 01-01-1994
DB71 Andre bændelormeinfestationer 01-01-1994
DB710 Hymenolepiasis 01-01-2012
DB711 Dipylidiasis 01-01-2012
DB718 Anden bændelormeinfestation 01-01-2012
DB719 Infestation med bændelorm UNS 01-01-1994
DB72 Dracunculiasis 01-01-1994
DB729 Dracunculiasis UNS 01-01-1994
DB73 Onchocerciasis 01-01-1994
DB739 Onchocerkose UNS 01-01-1994
DB74 Filariose 01-01-1994
DB740 Wuchereria bancrofti filariasis 01-01-1994
DB741 Brugia malayi filariasis 01-01-2012
DB742 Brugia timori filariasis 01-01-2012
DB743 Loa loa filariasis 01-01-2012
DB744 Mansonelliasis 01-01-2012
DB748 Anden filariose 01-01-2012
DB748B Dirofilariose 01-01-2012
DB749 Filariose UNS 01-01-1994
DB75 Trikinose 01-01-1994
DB759 Trikinose UNS 01-01-1994
DB76 Infestation med hageorm 01-01-1994
DB760 Ancylostomiasis 01-01-1994
DB761 Infestation med Necator americanus 01-01-1994
DB768 Anden form for infestation med hageorm 01-01-1994
DB769 Infestation med hageorm UNS 01-01-1994
DB769A Larva migrans cutanea UNS 01-01-1994
DB77 Askariose 01-01-1994
DB770 Intestinal ascariasis 01-01-1994
DB778 Ascariasis med anden komplikation 01-01-1994
DB779 Ascariasis UNS 01-01-1994
DB78 Strongyloidose 01-01-1994
DB780 Intestinal strongyloidiasis 01-01-2012
DB781 Kutan strongyloidiasis 01-01-2012
DB787 Dissemineret strongyloidiasis 01-01-2012
DB789 Strongyloidiasis UNS 01-01-1994
DB79 Infektion med piskeorm 01-01-1994
DB799 Infektion med piskeorm UNS 01-01-1994
DB80 Infektion med børneorm 01-01-1994
DB809 Infektion med børneorm UNS 01-01-1994
DB81 Andre intestinale ormeinfestationer IKA 01-01-1994
DB810 Anisakiasis 01-01-2012
DB811 Intestinal capillariasis 01-01-2012
DB812 Trichostrongyliasis 01-01-2012
DB813 Intestinal angiostrongyliasis 01-01-2012
DB814 Blandet intestinal ormeinfestation 01-01-1994
DB818 Anden intestinal ormeinfestation 01-01-1994
DB82 Intestinale infestationer med parasitter uden nærmere spec. 01-01-1994
DB820 Intestinal ormesygdom UNS 01-01-1994
DB829 Intestinal infestation med parasitter UNS 01-01-1994
DB83 Andre ormesygdomme 01-01-1994
DB830 Larva migrans visceralis 01-01-1994
DB830A Toxocariasis 01-01-2012
DB831 Gnathostomiasis 01-01-2012
DB832 Angiostrongyliasis forårsaget af Parastrongylus cantonensis 01-01-2012
DB833 Syngamiasis 01-01-2012
DB834 Intern infestation med igler 01-01-2012
DB838 Anden ormesygdom 01-01-1994
DB839 Ormesygdom UNS 01-01-1994
DB85 Infestation med lus 01-01-1994
DB850 Infestation med hovedlus 01-01-1994
DB851 Infestation med kropslus 01-01-1994
DB852 Infestation med lus UNS 01-01-1994
DB853 Infestation med fladlus 01-01-1994
DB854 Blandingsinfestation med lus 01-01-1994
DB86 Fnat 01-01-1994
DB869 Scabies UNS 01-01-1994
DB869A Scabies crustosa 01-04-2000
DB869B Persisterende noduli ved scabies 01-04-2000
DB87 Myiasis 01-01-1994
DB870 Kutan myiasis 01-01-2012
DB871 Myiasis i sår 01-01-2012
DB872 Okulær myiasis 01-01-2012
DB873 Nasofaryngeal myiasis 01-01-2012
DB874 Myiasis i øre 01-01-2012
DB878 Myiasis med anden lokalisation 01-01-2012
DB879 Myiasis UNS 01-01-1994
DB88 Andre infestationer med leddyr 01-01-1994
DB880 Anden sygdom fremkaldt af mider 01-04-2000
DB881 Infestation med sandlopper 01-01-1994
DB882 Infestation med andet leddyr 01-01-2012
DB883 Ekstern infestation med igler 01-01-2012
DB888 Anden infestation med leddyr 01-01-1994
DB888A Cheyletiella-infestation 01-04-2000
DB888B Infestation med væggelus 01-04-2000
DB888C Infestation med lopper 01-04-2000
DB888D Infestation med hårsækmider 01-04-2000
DB889 Infestation med leddyr UNS 01-01-1994
DB89 Sygdom forårsaget af parasit UNS 01-01-1994
DB899 Parasitær sygdom UNS 01-01-1994
DB899A Parasitæmi UNS 01-01-1996
DB90 Følger efter tuberkulose 01-01-1994
DB900 Følger efter tuberkulose i centralnervesystemet 01-01-1994
DB901 Følger efter tuberkulose i urin- og kønsorganer 01-01-1994
DB902 Følger efter tuberkulose i knogler og led 01-01-1994
DB902A Sequelae tuberculosis articulorum 01-01-1994 31-12-2011
DB902B Sequelae tuberculosis ossium 01-01-1994 31-12-2011
DB908 Følger efter tuberkulose i andet organ 01-01-1994
DB909 Følger eft TB i ånde-org. og u lokal. 01-01-1994
DB91 Følger efter polio 01-01-1994
DB919 Følger efter poliomyelitis 01-01-1994
DB92 Følger efter spedalskhed 01-01-1994
DB929 Følger efter lepra 01-01-1994
DB94 Følger efter andre infektiøse og parasitære sygdomme 01-01-1994
DB940 Følger efter trakom 01-01-1994
DB941 Følger efter viral hjernebetændelse 01-01-1994
DB942 Følger efter viral leverbetændelse 01-01-1994
DB948 Følger efter anden infektiøs eller parasitær sygdom 01-01-1994
DB948A Følger efter COVID-19 01-04-2020
DB949 Følger efter infektiøs eller parasitær sygdom UNS 01-01-1994
DB95 Streptokokker og stafylokokker som årsag til sygdom 01-01-1994
DB950 Streptokokker, gruppe A, som årsag til sygdom 01-01-1994
DB951 Streptokokker, gruppe B, som årsag til sygdom 01-01-2012
DB952 Streptokokker, gruppe D, som årsag til sygdom 01-01-2012
DB953 Pneumokokker som årsag til sygdom 01-01-1994
DB954 Anden streptokok som årsag til sygdom 01-01-2012
DB955 Streptokokker UNS som årsag til sygdom 01-01-1994
DB956 Staphylococcus aureus som årsag til sygdom 01-01-1994
DB956A Staphylococcus aureus methicillin resistent (MRSA) 01-05-2004
DB957 Anden stafylokok som årsag til sygdom 01-01-2012
DB958 Stafylokok UNS som årsag til sygdom 01-01-1994
DB96 Andre bakterier som årsag til sygdom 01-01-1994
DB960 Mycoplasma pneumoniae som årsag til sygdom 01-01-1994
DB961 Klebsiella pneumoniae om årsag til sygdom 01-01-1994
DB962 Escherichia coli som årsag til sygdom 01-01-1994
DB963 Haemophilus influenzae som årsag til sygdom 01-01-1994
DB964 Proteus som årsag til sygdom 01-01-1994
DB965 Pseudomonas som årsag til sygdom 01-01-1994
DB966 Bacillus fragilis som årsag til sygdom 01-01-1994
DB967 Clostridium perfringens som årsag til sygdom 01-01-1994
DB968 Anden bakterie som årsag til sygdom 01-01-1994
DB968A Helicobacter pylori som årsag til sygd klass i andre kap 01-07-2005 31-12-2011
DB97 Virus som årsag til sygdom 01-01-1994
DB970 Adenovirus som årsag til sygdom 01-01-1994
DB971 Enterovirus som årsag til sygdom 01-01-1994
DB972 Coronavirus som årsag til sygdom 01-01-1994
DB972A COVID-19 svær akut respiratorisk syndrom 01-12-2019
DB972B Multisystem inflammatorisk syndrom associeret med COVID-19 01-04-2020
DB972B1 Multisystem Inflammatory Syndrome in Children (MIS-C) 01-04-2020
DB973 Retrovirus som årsag til sygdom 01-01-1994
DB974 Respiratorisk syncytialvirus (RS-virus) som årsag til sygdom 01-01-1994
DB975 Reovirus som årsag til sygdom 01-01-1994
DB976 Parvovirus som årsag til sygdom 01-01-1994
DB977 Papillomavirus som årsag til sygdom 01-01-1994
DB978 Anden virus som årsag til sygdom 01-01-1994
DB98 Andre infektiøse agentia som årsag til sygdom 01-01-2012
DB980 Helicobacter pylori som årsag til sygdom 01-01-2012
DB981 Vibrio vulnificus som årsag til sygdom 01-01-2012
DB99 Andre eller ikke nærmere specificerede infektiøse sygdomme 01-01-1994
DB999 Anden eller ikke specificeret infektionssygdom 01-01-1994
DC00 Læbekræft 01-01-1994
DC000 Kræft i overlæbens yderside 01-01-1994
DC000M Kræft i overlæbens yderside med metastaser 01-01-2017 31-12-2021
DC001 Kræft i underlæbens yderside 01-01-1994
DC001M Kræft i underlæbens yderside med metastaser 01-01-2017 31-12-2021
DC002 Kræft i læbens yderside UNS 01-01-1994
DC002M Kræft i læbens yderside med metastaser 01-01-2017 31-12-2021
DC003 Kræft i overlæbens slimhinde 01-01-1994
DC003M Kræft i overlæbens slimhinde med metastaser 01-01-2017 31-12-2021
DC004 Kræft i underlæbens slimhinde 01-01-1994
DC004M Kræft i underlæbens slimhinde med metastaser 01-01-2017 31-12-2021
DC005 Kræft i læbens slimhinde UNS 01-01-1994
DC005M Kræft i læbens slimhinde med metastaser 01-01-2017 31-12-2021
DC006 Kræft i mundvig 01-01-1994
DC006M Kræft i mundvig med metastaser 01-01-2017 31-12-2021
DC008 Kræft i læbe overgribende flere lokalisationer 01-01-1994
DC008M Kræft i læbe overgrib. flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC009 Læbekræft UNS 01-01-1994
DC009M Læbekræft med metastaser 01-01-2017 31-12-2021
DC009X Lokalrecidiv fra læbekræft 01-04-2012 31-12-2021
DC01 Kræft i basis af tunge 01-01-1994
DC019 Kræft i tungebasis 01-01-1994
DC019M Kræft i tungebasis med metastaser 01-01-2017 31-12-2021
DC019X Lokalrecidiv fra kræft i tungebasis 01-04-2012 31-12-2021
DC02 Kræft i andre og ikke specificerede dele af tungen 01-01-1994
DC020 Kræft i tungens overside 01-01-1994
DC020M Kræft i tungens overside med metastaser 01-01-2017 31-12-2021
DC021 Kræft i tungeranden 01-01-1994
DC021A Kræft i tungespidsen 01-01-1994
DC021B Neopl mal linguae marginale 01-01-1994 31-12-2011
DC021M Kræft i tungeranden med metastaser 01-01-2017 31-12-2021
DC022 Kræft i tungens underside 01-01-1994
DC022A Kræft i tungebåndet 01-01-1994
DC022M Kræft i tungens underside med metastaser 01-01-2017 31-12-2021
DC023 Kræft i tungens forreste to tredjedele UNS 01-01-1994
DC023M Kræft i tungens forreste to tredjedele med metastaser 01-01-2017 31-12-2021
DC024 Kræft i tonsilla lingualis 01-01-1994
DC024M Kræft i tonsilla linguae med metastaser 01-01-2017 31-12-2021
DC028 Kræft i tungen overgribende flere lokalisationer 01-01-1994
DC028M Kræft i tungen overgrib. flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC029 Tungekræft UNS 01-01-1994
DC029M Tungekræft med metastaser 01-01-2017 31-12-2021
DC029X Lokalrecidiv fra tungekræft 01-04-2012 31-12-2021
DC03 Kræft i tandkødet 01-01-1994
DC030 Kræft i tandkødet i overmunden 01-01-1994
DC030M Kræft i tandkødet i overmunden med metastaser 01-01-2017 31-12-2021
DC031 Kræft i tandkødet i undermunden 01-01-1994
DC031M Kræft i tandkødet i undermunden med metastaser 01-01-2017 31-12-2021
DC039 Kræft i tandkødet UNS 01-01-1994
DC039M Kræft i tandkødet med metastaser 01-01-2017 31-12-2021
DC039X Lokalrecidiv fra kræft i tandkødet 01-04-2012 31-12-2021
DC04 Kræft i mundgulvet 01-01-1994
DC040 Kræft i mundgulvets forreste del 01-01-1994
DC040M Kræft i mundgulvets forreste del med metastaser 01-01-2017 31-12-2021
DC041 Kræft i mundgulvets laterale del 01-01-1994
DC041M Kræft i mundgulvets laterale del med metastaser 01-01-2017 31-12-2021
DC048 Kræft i mundgulvet overgribende flere lokalisationer 01-01-1994
DC048M Kræft i mundgulvet overgrib. flere lokalisation m metastaser 01-01-2017 31-12-2021
DC049 Kræft i mundgulvet UNS 01-01-1994
DC049M Kræft i mundgulvet med metastaser 01-01-2017 31-12-2021
DC049X Lokalrecidiv fra kræft i mundgulvet 01-04-2012 31-12-2021
DC05 Kræft i ganen 01-01-1994
DC050 Kræft i den hårde gane 01-01-1994
DC050M Kræft i den hårde gane med metastaser 01-01-2017 31-12-2021
DC051 Kræft i den bløde gane 01-01-1994
DC051M Kræft i den bløde gane med metastaser 01-01-2017 31-12-2021
DC052 Kræft i drøbelen 01-01-1994
DC052M Kræft i drøbelen med metastaser 01-01-2017 31-12-2021
DC058 Kræft i ganen overgribende flere lokalisationer 01-01-1994
DC058M Kræft i ganen overgrib. flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC059 Ganekræft UNS 01-01-1994
DC059M Kræft i ganen med metastaser 01-01-2017 31-12-2021
DC059X Lokalrecidiv fra ganekræft 01-04-2012 31-12-2021
DC06 Kræft i andre og ikke specificerede dele af mundhulen 01-01-1994
DC060 Kræft i kindens slimhinde 01-01-1994
DC060M Kræft i kindens slimhinde med metastaser 01-01-2017 31-12-2021
DC061 Kræft i vestibulum oris 01-01-1994
DC061M Kræft i vestibulum oris med metastaser 01-01-2017 31-12-2021
DC062 Kræft i slimhinden bag kindtænderne 01-01-1994
DC062M Kræft i slimhinden bag kindtænderne med metastaser 01-01-2017 31-12-2021
DC068 Kræft i mundhulen overgribende flere lokalisationer 01-01-1994
DC068M Kræft i mundhulen overgrib. flere lokalisation m metastaser 01-01-2017 31-12-2021
DC069 Kræft i mundhulen UNS 01-01-1994
DC069M Kræft i mundhulen med metastaser 01-01-2017 31-12-2021
DC069X Lokalrecidiv fra kræft i mundhulen 01-04-2012 31-12-2021
DC07 Kræft i ørespytkirtel 01-01-1994
DC079 Kræft i ørespytkirtel 01-01-1994
DC079M Kræft i ørespytkirtel med metastaser 01-01-2017 31-12-2021
DC079X Lokalrecidiv fra kræft i ørespytkirtel 01-04-2012 31-12-2021
DC08 Kræft i andre og ikke specificerede store spytkirtler 01-01-1994
DC080 Kræft i glandula submandibularis 01-01-1994
DC080M Kræft i glandula submandibularis med metastaser 01-01-2017 31-12-2021
DC081 Kræft i glandula sublingualis 01-01-1994
DC081M Kræft i glandula sublingualis med metastaser 01-01-2017 31-12-2021
DC088 Kræft i stor spytkirtel overgribende flere lokalisationer 01-01-1994
DC088M Kræft i stor spytkirtel overgrib. fl. lokalis. m metastaser 01-01-2017 31-12-2021
DC089 Kræft i stor spytkirtel UNS 01-01-1994
DC089M Kræft i stor spytkirtel med metastaser 01-01-2017 31-12-2021
DC089X Lokalrecidiv fra kræft i stor spytkirtel 01-04-2012 31-12-2021
DC09 Kræft i tonsiller 01-01-1994
DC090 Kræft i tonsilleje 01-01-1994
DC090A Neopl mal tonsillae, fossa 01-01-1994 31-12-2011
DC090B Neopl mal tonsillae, sinus 01-01-1994 31-12-2011
DC090M Kræft i tonsilleje med metastaser 01-01-2017 31-12-2021
DC091 Kræft i ganebuen 01-01-1994
DC091A Kræft i forreste ganebue 01-01-1994
DC091B Kræft i bageste ganebue 01-01-1994
DC091M Kræft i ganebuen med metastaser 01-01-2017 31-12-2021
DC092 Kræft i tonsilla palatina 01-01-1994
DC092M Kræft i tonsilla palatina med metastaser 01-01-2017 31-12-2021
DC098 Kræft i tonsil overgribende flere lokalisationer 01-01-1994
DC098M Kræft i tonsil overgrib. flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC099 Kræft i tonsil UNS 01-01-1994
DC099M Kræft i tonsil med metastaser 01-01-2017 31-12-2021
DC099X Lokalrecidiv fra kræft i tonsil 01-04-2012 31-12-2021
DC10 Kræft i mundsvælget 01-01-1994
DC100 Kræft i vallecula epiglottica 01-01-1994
DC100M Kræft i vallecula epiglottica med metastaser 01-01-2017 31-12-2021
DC101 Kræft i strubelågets forflade 01-01-1994
DC101M Kræft i strubelågets forflade med metastaser 01-01-2017 31-12-2021
DC102 Kræft i oropharynx lateralvæg 01-01-1994
DC102M Kræft i oropharynx lateralvæg med metastaser 01-01-2017 31-12-2021
DC103 Kræft i oropharynx bagvæg 01-01-1994
DC103M Kræft i oropharynx bagvæg med metastaser 01-01-2017 31-12-2021
DC104 Kræft i brankialcyste eller brankialfure 01-01-1994
DC104A Kræft i brankialcyste 01-01-1994
DC104B Kræft i brankialfure 01-01-1994
DC104M Kræft i brankialcyste eller brankialfure med metastaser 01-01-2017 31-12-2021
DC108 Kræft i mundsvælget overgribende flere lokalisationer 01-01-1994
DC108M Kræft i mundsvælg overgrib. flere lokalisation m metastaser 01-01-2017 31-12-2021
DC109 Kræft i mundsvælget UNS 01-01-1994
DC109M Kræft i mundsvælget med metastaser 01-01-2017 31-12-2021
DC109X Lokalrecidiv fra kræft i mundsvælget 01-04-2012 31-12-2021
DC11 Kræft i næsesvælget 01-01-1994
DC110 Kræft i næsesvælgets loft 01-01-1994
DC110M Kræft i næsesvælgets loft med metastaser 01-01-2017 31-12-2021
DC111 Kræft i næsesvælgets bagvæg 01-01-1994
DC111M Kræft i næsesvælgets bagvæg med metastaser 01-01-2017 31-12-2021
DC112 Kræft i næsesvælgets sidevæg 01-01-1994
DC112M Kræft i næsesvælgets sidevæg med metastaser 01-01-2017 31-12-2021
DC113 Kræft i næsesvælgets forvæg 01-01-1994
DC113M Kræft i næsesvælgets forvæg med metastaser 01-01-2017 31-12-2021
DC118 Kræft i næsesvælget overgribende flere lokalisationer 01-01-1994
DC118M Kræft i næsesvælg overgrib. flere lokalisation m metastaser 01-01-2017 31-12-2021
DC119 Kræft i næsesvælget UNS 01-01-1994
DC119M Kræft i næsesvælget med metastaser 01-01-2017 31-12-2021
DC119X Lokalrecidiv fra kræft i næsesvælget 01-04-2012 31-12-2021
DC12 Kræft i recessus piriformis 01-01-1994
DC129 Kræft i recessus piriformis 01-01-1994
DC129M Kræft i recessus piriformis med metastaser 01-01-2017 31-12-2021
DC129X Lokalrecidiv fra kræft i recessus piriformis 01-04-2012 31-12-2021
DC13 Kræft i hypopharynx 01-01-1994
DC130 Kræft i regio postcricoideae 01-01-1994
DC130M Kræft i regio postcricoideae med metastaser 01-01-2017 31-12-2021
DC131 Kræft i plica aryepiglottica 01-01-1994
DC131M Kræft i plica aryepiglottica med metastaser 01-01-2017 31-12-2021
DC132 Kræft i hypopharynx bagvæg 01-01-1994
DC132M Kræft i hypopharynx bagvæg med metastaser 01-01-2017 31-12-2021
DC138 Kræft i hypopharynx overgribende flere lokalisationer 01-01-1994
DC138M Kræft i hypopharynx overgrib. fl. lokalisation m metastaser 01-01-2017 31-12-2021
DC139 Kræft i hypopharynx UNS 01-01-1994
DC139M Kræft i hypopharynx med metastaser 01-01-2017 31-12-2021
DC139X Lokalrecidiv fra kræft i hypopharynx 01-04-2012 31-12-2021
DC14 Kræft m. andre og dårligt spec. lokal. i læbe, mund og svælg 01-01-1994
DC140 Kræft i svælget UNS 01-01-1994
DC140M Kræft i svælget med metastaser 01-01-2017 31-12-2021
DC140X Lokalrecidiv fra kræft i svælget 01-04-2012 31-12-2021
DC141 Kræft i laryngopharynx 01-01-1994
DC141M Kræft i laryngopharynx med metastaser 01-01-2017 31-12-2021
DC142 Kræft i Waldeyers ring 01-01-1994
DC142M Kræft i Waldeyers ring med metastaser 01-01-2017 31-12-2021
DC148 Kræft i læbe, mundhule og svælg overgrib.fl.lokal. 01-01-1994
DC148M Kræft i læbe,mundhule,svælg overgrib.fl.lokal. m metastaser 01-01-2017 31-12-2021
DC15 Kræft i spiserøret 01-01-1994
DC150 Neopl mal oesophagi pars cervicalis 01-01-1994 31-12-2011
DC151 Neopl mal oesophagi pars thoracalis 01-01-1994 31-12-2011
DC152 Neopl mal oesophagi pars abdominalis 01-01-1994 31-12-2011
DC153 Kræft i spiserørets øverste tredjedel 01-01-1994
DC153M Kræft i spiserørets øverste tredjedel med metastaser 01-01-2017 31-12-2021
DC154 Kræft i spiserørets midterste tredjedel 01-01-1994
DC154M Kræft i spiserørets midterste tredjedel med metastaser 01-01-2017 31-12-2021
DC155 Kræft i spiserørets nederste tredjedel 01-01-1994
DC155M Kræft i spiserørets nederste tredjedel med metastaser 01-01-2017 31-12-2021
DC158 Kræft i spiserøret overgribende flere lokalisationer 01-01-1994
DC158M Kræft i spiserøret overgrib. flere lokalisation m metastaser 01-01-2017 31-12-2021
DC159 Kræft i spiserøret UNS 01-01-1994
DC159M Kræft i spiserøret med metastaser 01-01-2017 31-12-2021
DC159X Lokalrecidiv fra kræft i spiserøret 01-04-2012 31-12-2021
DC16 Kræft i mavesækken 01-01-1994
DC160 Kræft i cardia 01-01-1994
DC160M Kræft i cardia med metastaser 01-01-2017 31-12-2021
DC161 Kræft i fundus ventriculi 01-01-1994
DC161M Kræft i fundus ventriculi med metastaser 01-01-2017 31-12-2021
DC162 Kræft i corpus ventriculi 01-01-1994
DC162M Kræft i corpus ventriculi med metastaser 01-01-2017 31-12-2021
DC163 Kræft i antrum pyloricum 01-01-1994
DC163M Kræft i antrum pyloricum med metastaser 01-01-2017 31-12-2021
DC164 Kræft i pylorus 01-01-1994
DC164M Kræft i pylorus med metastaser 01-01-2017 31-12-2021
DC165 Kræft i curvatura gastrica minor 01-01-1994
DC165M Kræft i curvatura gastrica minor med metastaser 01-01-2017 31-12-2021
DC166 Kræft i curvatura gastrica major 01-01-1994
DC166M Kræft i curvatura gastrica major med metastaser 01-01-2017 31-12-2021
DC168 Kræft i mavesækken overgribende flere lokalisationer 01-01-1994
DC168M Kræft i mavesæk overgrib. flere lokalisationer m metastaser 01-01-2017 31-12-2021
DC169 Kræft i mavesækken UNS 01-01-1994
DC169M Kræft i mavesækken med metastaser 01-01-2017 31-12-2021
DC169X Lokalrecidiv fra kræft i mavesækken 01-04-2012 31-12-2021
DC17 Kræft i tyndtarmen 01-01-1994
DC170 Kræft i tolvfingertarmen 01-01-1994
DC170M Kræft i tolvfingertarmen med metastaser 01-01-2017 31-12-2021
DC171 Kræft i jejunum 01-01-1994
DC171M Kræft i jejunum med metastaser 01-01-2017 31-12-2021
DC172 Kræft i ileum 01-01-1994
DC172M Kræft i ileum med metastaser 01-01-2017 31-12-2021
DC173 Kræft i Meckels divertikel 01-01-1994
DC173M Kræft i Meckels divertikel med metastaser 01-01-2017 31-12-2021
DC178 Kræft i tyndtarmen overgribende flere lokalisationer 01-01-1994
DC178M Kræft i tyndtarm overgrib. flere lokalisationer m metastaser 01-01-2017 31-12-2021
DC179 Kræft i tyndtarmen UNS 01-01-1994
DC179M Kræft i tyndtarmen med metastaser 01-01-2017 31-12-2021
DC179X Lokalrecidiv fra kræft i tyndtarmen 01-04-2012 31-12-2021
DC18 Kræft i tyktarmen 01-01-1994
DC180 Kræft i caecum 01-01-1994
DC180A Kræft i valva ileocaecalis 01-01-1994
DC180M Kræft i caecum med metastaser 01-01-2017 31-12-2021
DC181 Kræft i blindtarmen 01-01-1994
DC181M Kræft i blindtarmen med metastaser 01-01-2017 31-12-2021
DC182 Kræft i colon ascendens 01-01-1994
DC182M Kræft i colon ascendens med metastaser 01-01-2017 31-12-2021
DC183 Kræft i flexura coli dextra 01-01-1994
DC183M Kræft i flexura coli dextra med metastaser 01-01-2017 31-12-2021
DC184 Kræft i colon transversum 01-01-1994
DC184M Kræft i colon transversum med metastaser 01-01-2017 31-12-2021
DC185 Kræft i flexura coli sinistra 01-01-1994
DC185M Kræft i flexura coli sinistra med metastaser 01-01-2017 31-12-2021
DC186 Kræft i colon descendens 01-01-1994
DC186M Kræft i colon descendens med metastaser 01-01-2017 31-12-2021
DC187 Kræft i colon sigmoideum 01-01-1994
DC187M Kræft i colon sigmoideum med metastaser 01-01-2017 31-12-2021
DC188 Kræft i tyktarmen overgribende flere lokalisationer 01-01-1994
DC188A Hereditær non-polypøs kolorektal cancer (HNPCC) 01-01-2000
DC188M Kræft i tyktarm overgrib. flere lokalisationer m metastaser 01-01-2017 31-12-2021
DC189 Kræft i tyktarmen UNS 01-01-1994
DC189M Kræft i tyktarmen med metastaser 01-01-2017 31-12-2021
DC189X Lokalrecidiv fra kræft i tyktarmen 01-04-2012 31-12-2021
DC19 Kræft på overgangen mellem tyktarm og endetarm 01-01-1994 30-09-2008
DC199 Neopl mal rectosigmoidei 01-01-1994 30-04-2008
DC20 Kræft i endetarmen 01-01-1994
DC209 Kræft i endetarmen 01-01-1994
DC209M Kræft i endetarmen med metastaser 01-01-2017 31-12-2021
DC209X Lokalrecidiv fra kræft i endetarmen 01-04-2012 31-12-2021
DC21 Kræft i endetarmsåbningen og analkanalen 01-01-1994
DC210 Kræft i endetarmsåbningen UNS 01-01-1994
DC210D Neoplasma malignum ani, basocellulært, nodulært 01-04-2006 31-12-2011
DC210E Neoplasma malignum ani, basocellulært, superficielt 01-04-2006 31-12-2011
DC210F Neoplasma malignum ani, basocellulært, morphaeatype 01-04-2006 31-12-2011
DC210G Neoplasma malignum ani, basocellulært, multiplex 01-04-2006 31-12-2011
DC210H Neoplasma malignum ani, basocellulært, recidivans 01-04-2006 31-12-2011
DC210J Ne mal ani, plan, verr (cun, B-L) 01-04-2006 31-12-2011
DC210K Neoplasma malignum ani, planocellulært, spinocellulært 01-04-2006 31-12-2011
DC210L Neoplasma malignum ani, planocellulært, Marjorlin/Melaney 01-04-2006 31-12-2011
DC210M Kræft i endetarmsåbningen med metastaser 01-04-2006 31-12-2021
DC210N Neoplasma malignum ani, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC210P Neoplasma malignum ani, Merkelcelle karcinom 01-04-2006 31-12-2011
DC210Q Neoplasma malignum ani, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC210R Neoplasma malignum ani, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC210S Neoplasma malignum ani, porokarcinom 01-04-2006 31-12-2011
DC210T Neoplasma malignum ani, sebaceøst karcinom 01-04-2006 31-12-2011
DC210U Neoplasma malignum ani, trichillemmalt karcinom 01-04-2006 31-12-2011
DC210V Neoplasma malignum ani, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC210W Neoplasma malignum ani, angiosarkom 01-04-2006 31-12-2011
DC210X Lokalrecidiv fra kræft i endetarmsåbningen 01-04-2012 31-12-2021
DC210Z Neoplasma malignum ani, andet 01-04-2006 31-12-2011
DC211 Kræft i analkanalen 01-01-1994
DC211M Kræft i analkanalen med metastaser 01-01-2017 31-12-2021
DC211X Lokalrecidiv fra kræft i analkanalen 01-04-2012 31-12-2021
DC212 Neoplasma malignum cloacogenica ani 01-01-1994
DC212M Neoplasma malignum cloacogenica ani med metastaser 01-01-2017 31-12-2021
DC218 Kræft i endetarm, åbning og analkanal, overgrib. lokal. 01-01-1994
DC218M Kræft i endetarm og analkanal, overgrib. lokal. m metastaser 01-01-2017 31-12-2021
DC22 Kræft i leveren og intrahepatiske galdegange 01-01-1994
DC220 Hepatocellulært karcinom 01-01-1994
DC220M Hepatocellulært karcinom med metastaser 01-01-2017 31-12-2021
DC221 Kræft i intrahepatiske galdegange 01-01-1994
DC221A Cholangiocarcinoma, intrahepatisk 01-01-2012
DC221M Kræft i intrahepatiske galdegange med metastaser 01-01-2017 31-12-2021
DC222 Hepatoblastom 01-01-1994
DC222M Hepatoblastom med metastaser 01-01-2017 31-12-2021
DC223 Angiosarkom i leveren 01-01-1994
DC223M Angiosarkom i leveren med metastaser 01-01-2017 31-12-2021
DC224 Anden form for sarkom i leveren 01-01-1994
DC224M Anden form for sarkom i leveren med metastaser 01-01-2017 31-12-2021
DC227 Anden kræft i leveren 01-01-1994
DC227M Anden kræft i leveren med metastaser 01-01-2017 31-12-2021
DC229 Kræft i leveren UNS 01-01-1994
DC229M Kræft i leveren med metastaser 01-01-2017 31-12-2021
DC229X Lokalrecidiv fra kræft i leveren 01-04-2012 31-12-2021
DC23 Kræft i galdeblæren 01-01-1994
DC239 Kræft i galdeblæren 01-01-1994
DC239M Kræft i galdeblæren med metastaser 01-01-2017 31-12-2021
DC239X Lokalrecidiv fra kræft i galdeblæren 01-04-2012 31-12-2021
DC24 Kræft i andre og ikke specificerede dele af galdeveje 01-01-1994
DC240 Kræft i ekstrahepatiske galdeveje 01-01-1994
DC240A Kræft i ductus choledochus 01-01-1994
DC240B Kræft i ductus cysticus 01-01-1994
DC240C Kræft i ductus hepaticus communis 01-01-1994
DC240D Kræft i ductus hepaticus dexter 01-01-1994
DC240E Kræft i ductus hepaticus sinister 01-01-1994
DC240M Kræft i ekstrahepatiske galdeveje med metastaser 01-01-2017 31-12-2021
DC241 Kræft i papilla Vateri 01-01-1994
DC241M Kræft i papilla Vateri med metastaser 01-01-2017 31-12-2021
DC248 Kræft i galdeveje overgribende flere lokalisationer 01-01-1994
DC248M Kræft i galdeveje overgrib. flere lokalisation m metastaser 01-01-2017 31-12-2021
DC249 Kræft i galdeveje UNS 01-01-1994
DC249M Kræft i galdeveje med metastaser 01-01-2017 31-12-2021
DC249X Lokalrecidiv fra kræft i galdeveje 01-04-2012 31-12-2021
DC25 Kræft i bugspytkirtlen 01-01-1994
DC250 Kræft i caput pancreatis 01-01-1994
DC250M Kræft i caput pancreatis med metastaser 01-01-2017 31-12-2021
DC251 Kræft i corpus pancreatis 01-01-1994
DC251M Kræft i corpus pancreatis med metastaser 01-01-2017 31-12-2021
DC252 Kræft i cauda pancreatis 01-01-1994
DC252M Kræft i cauda pancreatis med metastaser 01-01-2017 31-12-2021
DC253 Kræft i ductus pancreaticus 01-01-1994
DC253M Kræft i ductus pancreaticus med metastaser 01-01-2017 31-12-2021
DC254 Kræft i Langerhanske øer 01-01-1994
DC254M Kræft i Langerhanske øer med metastaser 01-01-2017 31-12-2021
DC257 Kræft i andre dele af pancreas 01-01-1994
DC257M Kræft i andre dele af pancreas med metastaser 01-01-2017 31-12-2021
DC258 Kræft i pancreas overgribende flere lokalisationer 01-01-1994
DC258M Kræft i pancreas overgrib. fl. lokalisationer m metastaser 01-01-2017 31-12-2021
DC259 Kræft i pancreas UNS 01-01-1994
DC259M Kræft i pancreas med metastaser 01-01-2017 31-12-2021
DC259X Lokalrecidiv fra kræft i pancreas 01-04-2012 31-12-2021
DC26 Kræft i andre og dårligt specificerede fordøjelsesorganer 01-01-1994
DC260 Kræft i mave-tarm-kanalen UNS 01-01-1994
DC260M Kræft i tarmkanalen med metastaser 01-01-2017 31-12-2021
DC261 Kræft i milten 01-01-1994
DC261M Kræft i milten med metastaser 01-01-2017 31-12-2021
DC268 Kræft i fordøj-org. overgrib.fl.lokal. 01-01-1994
DC268M Kræft i fordøjelsesorg. overgrib. fl.lokalisat. m metastaser 01-01-2017 31-12-2021
DC269 Kræft i fordøjelseorganerne UNS 01-01-1994
DC269M Kræft i fordøjelsesorganerne med metastaser 01-01-2017 31-12-2021
DC269X Lokalrecidiv fra kræft i fordøjelseorganerne 01-04-2012 31-12-2021
DC30 Kræft i næsehulen og mellemøret 01-01-1994
DC300 Kræft i næsehulen 01-01-1994
DC300A Kræft i concha nasi 01-01-1994
DC300B Kræft i næseskillevæggen 01-01-1994
DC300C Kræft i vestibulum nasi 01-01-1994
DC300M Kræft i næsehulen med metastaser 01-01-2017 31-12-2021
DC300X Lokalrecidiv fra kræft i næsehulen 01-04-2012 31-12-2021
DC301 Kræft i mellemøre 01-01-1994
DC301A Kræft i cellulae mastoideae 01-01-1994
DC301B Kræft i tuba auditiva 01-01-1994
DC301M Kræft i mellemøre med metastaser 01-01-2017 31-12-2021
DC301X Lokalrecidiv fra kræft i mellemøre 01-04-2012 31-12-2021
DC31 Kræft i bihuler 01-01-1994
DC310 Kræft i kæbehulen 01-01-1994
DC310M Kræft i kæbehulen med metastaser 01-01-2017 31-12-2021
DC311 Kræft i sinus ethmoidalis 01-01-1994
DC311M Kræft i sinus ethmoidalis med metastaser 01-01-2017 31-12-2021
DC312 Kræft i pandehulen 01-01-1994
DC312M Kræft i pandehulen med metastaser 01-01-2017 31-12-2021
DC313 Kræft i sinus sphenoidalis 01-01-1994
DC313M Kræft i sinus sphenoidalis med metastaser 01-01-2017 31-12-2021
DC318 Kræft i bihuler overgribende flere lokalisationer 01-01-1994
DC318M Kræft i bihuler overgrib. flere lokalisationer m metastaser 01-01-2017 31-12-2021
DC319 Kræft i bihule UNS 01-01-1994
DC319M Kræft i bihule med metastaser 01-01-2017 31-12-2021
DC319X Lokalrecidiv fra kræft i bihule 01-04-2012 31-12-2021
DC32 Kræft i strubehovedet 01-01-1994
DC320 Kræft i glottis 01-01-1994
DC320A Kræft i stemmelæbe 01-01-1994
DC320M Kræft i glottis med metastaser 01-01-2017 31-12-2021
DC321 Kræft i strubehovedet lokaliseret oven for glottis 01-01-1994
DC321A Kræft i epiglottis' bagflade 01-01-1994
DC321B Kræft i epiglottis lokaliseret over os hyoideum 01-01-1994
DC321C Kræft i laryngeale side af plica aryepiglottica 01-01-1994
DC321D Kræft i falsk stemmelæbe 01-01-1994
DC321M Kræft i strubehovedet lokalis. ovenfor glottis m metastaser 01-01-2017 31-12-2021
DC322 Kræft i strubehovedet lokaliseret neden for glottis 01-01-1994
DC322M Kræft i strubehovedet lokalis. nedenfor glottis m metastaser 01-01-2017 31-12-2021
DC323 Kræft i brusk i strubehovedet 01-01-1994
DC323M Kræft i brusk i strubehovedet med metastaser 01-01-2017 31-12-2021
DC328 Kræft i strubehovedet overgribende flere lokalisationer 01-01-1994
DC328M Kræft i strubehoved overgrib flere lokalisat med metastaser 01-01-2017 31-12-2021
DC329 Kræft i strubehovedet UNS 01-01-1994
DC329M Kræft i strubehovedet med metastaser 01-01-2017 31-12-2021
DC329X Lokalrecidiv fra kræft i strubehovedet 01-04-2012 31-12-2021
DC33 Kræft i luftrøret 01-01-1994
DC339 Kræft i luftrøret 01-01-1994
DC339M Kræft i luftrøret med metastaser 01-01-2017 31-12-2021
DC339X Lokalrecidiv fra kræft i luftrøret 01-04-2012 31-12-2021
DC34 Kræft i bronkier og lunge 01-01-1994
DC340 Kræft i hovedbronkie 01-01-1994
DC340A Kræft i lungehilus 01-01-1994
DC340B Kræft i carina tracheae 01-01-1994
DC340M Kræft i hovedbronkien med metastaser 01-01-2017 31-12-2021
DC341 Kræft i lungens øverste lap 01-01-1994
DC341M Kræft i lungens øverste lap med metastaser 01-01-2017 31-12-2021
DC342 Kræft i lungens mellemste lap 01-01-1994
DC342M Kræft i lungens mellemste lap med metastaser 01-01-2017 31-12-2021
DC343 Kræft i lungens nederste lap 01-01-1994
DC343M Kræft i lungens nederste lap med metastaser 01-01-2017 31-12-2021
DC348 Kræft i bronkier og lunge overgribende flere lokalisationer 01-01-1994
DC348M Kræft i bronkier og lunge overgrib. fl. lokalis m metastaser 01-01-2017 31-12-2021
DC349 Kræft i lunge UNS 01-01-1994
DC349M Kræft i bronkier eller lunge med metastaser 01-01-2017 31-12-2021
DC349X Lokalrecidiv fra kræft i lunge 01-04-2012 31-12-2021
DC37 Kræft i thymus 01-01-1994
DC379 Kræft i thymus 01-01-1994
DC379M Kræft i thymus med metastaser 01-01-2017 31-12-2021
DC379X Lokalrecidiv fra kræft i thymus 01-04-2012 31-12-2021
DC38 Kræft i hjerte, mediastinum og lungehinde 01-01-1994
DC380 Kræft i hjertet 01-01-1994
DC380A Kræft i perikardiet 01-01-1994
DC380AM Kræft i perikardiet med metastaser 01-01-2017 30-09-2022
DC380AX Lokalrecidiv fra kræft i perikardiet 01-04-2012 30-09-2022
DC380M Kræft i hjertet med metastaser 01-01-2017 31-12-2021
DC380X Lokalrecidiv fra kræft i hjertet 01-04-2012 31-12-2021
DC381 Kræft i mediastinum anterius 01-01-1994
DC381M Kræft i mediastinum anterius med metastaser 01-01-2017 31-12-2021
DC382 Kræft i mediastinum posterius 01-01-1994
DC382M Kræft i mediastinum posterius med metastaser 01-01-2017 31-12-2021
DC383 Kræft i mediastinum UNS 01-01-1994
DC383M Kræft i mediastinum med metastaser 01-01-2017 31-12-2021
DC383X Lokalrecidiv fra kræft i mediastinum 01-04-2012 31-12-2021
DC384 Kræft i lungehinde 01-01-1994
DC384M Kræft i lungehinde med metastaser 01-01-2017 31-12-2021
DC384X Lokalrecidiv fra kræft i lungehinde 01-04-2012 31-12-2021
DC388 Kræft i hjerte, mediastinum og lungehinde overgrib.fl.lokal. 01-01-1994
DC388M Kræft i hjerte, mediast, lungehinde overgribende m.metastase 01-01-2017 31-12-2021
DC39 Kræft med anden/uspec. lokal. i åndedræts-/brysthuleorganer 01-01-1994
DC390 Kræft i øvre luftveje UNS 01-01-1994
DC390M Kræft i øvre luftveje med metastaser 01-01-2017 31-12-2021
DC398 Kræft i brysthule og luftveje overgrib.fl.lokal. 01-01-1994
DC398M Kræft i brysthule og luftveje overgrib.fl.lokal. m metastase 01-01-2017 31-12-2021
DC399 Kræft i åndedrætsorg./brysthuleorg. med dårligt spec. lokal. 01-01-1994
DC399M Kræft i åndedræts-/brysthuleorgan med metastaser 01-01-2017 31-12-2021
DC399X Lokalrecidiv fra kræft i åndedrætsorgan el organ i brysthule 01-04-2012 31-12-2021
DC40 Kræft i knogler og ledbrusk i ekstremiteter 01-01-1994
DC400 Kræft i skulderblad, lange knogler eller ledbrusk i arm 01-01-1994
DC400A Kræft i ledbrusk på lang knogle i overekstremitet 01-01-1994
DC400B Kræft i ledbrusk på skulderblad 01-01-1994
DC400C Knoglekræft i lang knogle i overekstremitet 01-01-1994
DC400D Knoglekræft i skulderblad 01-01-1994
DC400M Kræft i skulderblad/lang knogle/ledbrusk i arm m.metastaser 01-01-2017 31-12-2021
DC401 Kræft i kort knogle eller ledbrusk i overekstremitet 01-01-1994
DC401A Kræft i ledbrusk på kort knogle i overekstremitet 01-01-1994
DC401B Knoglekræft i kort knogle i overekstremitet 01-01-1994
DC401M Kræft i kort knogle/ledbrusk i overekstremitet m.metastaser 01-01-2017 31-12-2021
DC402 Kræft i lang knogle eller ledbrusk i underekstremitet 01-01-1994
DC402A Kræft i ledbrusk på lang knogle i underekstremitet 01-01-1994
DC402B Knoglekræft i lang knogle i underekstremitet 01-01-1994
DC402M Kræft i lang knogle/ledbrusk i underekstremitet m.metastaser 01-01-2017 31-12-2021
DC403 Kræft i kort knogle eller ledbrusk i underekstremitet 01-01-1994
DC403A Kræft i ledbrusk på kort knogle i underekstremitet 01-01-1994
DC403B Knoglekræft i kort knogle i underekstremitet 01-01-1994
DC403M Kræft i kort knogle/ledbrusk i underekstremitet m.metastase 01-01-2017 31-12-2021
DC408 Kræft i knogle og ledbrusk i ekstremitet overgrib.fl.lokal. 01-01-1994
DC408A Neopl mal cartilaginis articuli extremitatum, flere regione 01-01-1994 31-12-2011
DC408B Neopl mal ossium extremitatum, flere regioner 01-01-1994 31-12-2011
DC408M Kræft i knogle/ledbrusk i ekstremitet overgrib. m.metastase 01-01-2017 31-12-2021
DC409 Kræft i knogle eller ledbrusk i ekstremitet UNS 01-01-1994
DC409A Neopl mal cartilaginis articuli extremitatum uden specifik 01-01-1994 31-12-2011
DC409B Neopl mal ossium extremitatum uden specifikation 01-01-1994 31-12-2011
DC409M Kræft i knogle eller ledbrusk i ekstremitet med metastaser 01-01-2017 31-12-2021
DC409X Lokalrecidiv fra kræft i knogle eller ledbrusk i ekstremitet 01-04-2012 31-12-2021
DC41 Kræft i knogler og ledbrusk med andre og ikke spec. lokal. 01-01-1994
DC410 Kræft i kranie eller ansigtsknogle 01-01-1994
DC410A Kræft i kranieknogle 01-01-1994
DC410B Kræft i ansigtsknogle UNS 01-01-1994
DC410C Kræft i ledbrusk i kraniet 01-01-1994
DC410D Kræft i ledbrusk i ansigtet 01-01-1994
DC410E Knoglekræft i overkæben 01-01-2012
DC410F Knoglekræft i øjenhule 01-01-2012
DC410G Kræft i ledbrusk i overkæben 01-01-2012
DC410M Kræft i kranie eller ansigtsknogle med metastaser 01-01-2017 31-12-2021
DC411 Kræft i underkæben 01-01-1994
DC411A Kræft i ledbrusk i underkæben 01-01-1994
DC411M Kræft i underkæben med metastaser 01-01-2017 31-12-2021
DC412 Kræft i rygsøjlen 01-01-1994
DC412A Kræft i ledbrusk i rygsøjlen 01-01-1994
DC412B Knoglekræft i ryghvirvel 01-01-2012
DC412M Kræft i rygsøjlen med metastaser 01-01-2017 31-12-2021
DC413 Kræft i ribben, brystben eller kraveben 01-01-1994
DC413A Kræft i ledbrusk på kraveben 01-01-1994
DC413B Kræft i ribbensbrusk 01-01-1994
DC413C Kræft i brystbenets ledbrusk 01-01-1994
DC413D Kræft i kraveben 01-01-1994
DC413E Kræft i ribben 01-01-1994
DC413F Kræft i brystbenet 01-01-1994
DC413M Kræft i ribben, brystben eller kraveben med metastaser 01-01-2017 31-12-2021
DC414 Kræft i bækken, korsben eller haleben 01-01-1994
DC414A Kræft i brusk i halebenet 01-01-1994
DC414B Kræft i brusk i bækkenet 01-01-1994
DC414C Kræft i brusk i korsbenet 01-01-1994
DC414D Knoglekræft i halebenet 01-01-1994
DC414E Knoglekræft i bækkenknogle 01-01-1994
DC414F Knoglekræft i korsbenet 01-01-1994
DC414M Kræft i bækken, korsben eller haleben med metastaser 01-01-2017 31-12-2021
DC418 Kræft i knogle/ledbrusk overgribende flere lokalisationer 01-01-1994
DC418A Neopl mal cartilag articuli, flere reg (ikke ekstremiteter) 01-01-1994 31-12-2011
DC418B Neopl mal ossis, flere regioner (ikke extremiteter) 01-01-1994 31-12-2011
DC418M Kræft i knogle/ledbrusk overgrib. fl.lokalisat m.metastaser 01-01-2017 31-12-2021
DC419 Kræft i knogle eller ledbrusk UNS 01-01-1994
DC419A Kræft i ledbrusk UNS 01-01-1994
DC419B Kræft i knogle UNS 01-01-1994
DC419M Kræft i knogle eller ledbrusk med metastaser 01-01-2017 31-12-2021
DC419X Lokalrecidiv fra kræft i knogle eller ledbrusk 01-04-2012 31-12-2021
DC43 Modermærkekræft i huden 01-01-1994
DC430 Malignt melanom i hud på læbe 01-01-1994
DC430E Malignt melanom i læbe, lentigo maligna 01-04-2006 31-12-2011
DC430F Malignt melanom i læbe, superficielt spred 01-04-2006 31-12-2011
DC430G Malignt melanom i læbe, nodulært 01-04-2006 31-12-2011
DC430H Malignt melanom i læbe, akralt lentiginøst 01-04-2006 31-12-2011
DC430J Malignt melanom i læbe, malignt blue naevus 01-04-2006 31-12-2011
DC430K Malignt melanom i læbe, desmoplastisk 01-04-2006 31-12-2011
DC430M Malignt melanom i hud på læbe med metastaser 01-01-2017 31-12-2021
DC430Z Malignt melanom i læbe, anden type 01-04-2006 31-12-2011
DC431 Malignt melanom i hud på øjenlåg 01-01-1994
DC431A Malignt melanom i øjenkrog 01-01-1994
DC431B Malignt melanom i øjenlåg 01-01-1994
DC431E Malignt melanom i øjenlåg, lentigo maligna 01-04-2006 31-12-2011
DC431F Malignt melanom i øjenlåg, superficielt spred 01-04-2006 31-12-2011
DC431G Malignt melanom i øjenlåg, nodulært 01-04-2006 31-12-2011
DC431H Malignt melanom i øjenlåg, akralt lentiginøst 01-04-2006 31-12-2011
DC431J Malignt melanom i øjenlåg, malignt blue naevus 01-04-2006 31-12-2011
DC431K Malignt melanom i øjenlåg, desmoplastisk 01-04-2006 31-12-2011
DC431M Malignt melanom i hud på øjenlåg med metastaser 01-01-2017 31-12-2021
DC431Z Malignt melanom i øjenlåg, anden type 01-04-2006 31-12-2011
DC432 Malignt melanom i hud på øre eller i ydre øregang 01-01-1994
DC432A Malignt melanom i hud på øre 01-01-1994
DC432B Malignt melanom i hud i ydre øregang 01-01-1994
DC432C Malignt melanom i hud i meatus acusticus externus u. specif 01-01-1994 31-12-2011
DC432E Malignt melanom i hud i ydre øre, lentigo mal 01-04-2006 31-12-2011
DC432F Malignt melanom i hud i ydre øre, superfic. spred 01-04-2006 31-12-2011
DC432G Malignt melanom i hud i ydre øre, nodulært 01-04-2006 31-12-2011
DC432H Malignt melanom i hud i ydre øre, akralt lentiginøst 01-04-2006 31-12-2011
DC432J Malignt melanom i hud i ydre øre, malignt blue naevus 01-04-2006 31-12-2011
DC432K Malignt melanom i hud i ydre øre, desmoplstisk 01-04-2006 31-12-2011
DC432M Malignt melanom i hud på øre/i ydre øregang med metastaser 01-01-2017 31-12-2021
DC432Z Malignt melanom i hud i ydre øre, anden type 01-04-2006 31-12-2011
DC433 Malignt melanom med anden/ikke spec. lokalisation i ansigtet 01-01-1994
DC433E Malignt melanom i hud i ansigt, an/uspec, lentigo maligna 01-04-2006 31-12-2011
DC433F Malignt melanom i hud i ansigt, an/usepc, superfic. spred 01-04-2006 31-12-2011
DC433G Malignt melanom i hud i ansigt, an/uspec, nodulært 01-04-2006 31-12-2011
DC433H Malignt melanom i hud i ansigt, an/uspec, akralt lentiginøst 01-04-2006 31-12-2011
DC433J Malignt melanom i hud i ansigt, an/uspec, malignt blue naev 01-04-2006 31-12-2011
DC433K Malignt melanom i hud i ansigt, an/uspec, desmoplastisk 01-04-2006 31-12-2011
DC433M Malignt melanom i ansigtet med metastaser 01-01-2017 31-12-2021
DC433Z Malignt melanom i hud i ansigt, an/uspec, anden type 01-04-2006 31-12-2011
DC434 Malignt melanom i hud på skalpen eller halsen 01-01-1994
DC434A Malignt melanom i hud på skalpen 01-01-1994
DC434B Malignt melanom i hud på halsen 01-01-1994
DC434E Malignt melanom i hud på skalp og hals, lentigo maligna 01-04-2006 31-12-2011
DC434F Malignt melanom i hud på skalp og hals, superfic. spred 01-04-2006 31-12-2011
DC434G Malignt melanom i hud på skalp og hals, nodulært 01-04-2006 31-12-2011
DC434H Malignt melanom i hud på skalp og hals, akralt lentiginøst 01-04-2006 31-12-2011
DC434J Malignt melanom i hud på skalp og hals, malignt blue naevus 01-04-2006 31-12-2011
DC434K Malignt melanom i hud på skalp og hals, desmoplastisk 01-04-2006 31-12-2011
DC434M Malignt melanom i hud på skalpen eller halsen med metastaser 01-01-2017 31-12-2021
DC434Z Malignt melanom i hud på skalp og hals, anden type 01-04-2006 31-12-2011
DC435 Malignt melanom i hud på kroppen 01-01-1994
DC435A Malignt melanom i hud i anus 01-01-1994
DC435B Malignt melanom i hud på bryst 01-01-1994
DC435C Malignt melanom i hud i perineum 01-01-1994
DC435D LUKKES 01-01-1994 01-04-2009
DC435E Malignt melanom i hud på truncus, lentigo maligna 01-04-2006 31-12-2011
DC435F Malignt melanom i hud på truncus, superfic. spred 01-04-2006 31-12-2011
DC435G Malignt melanom i hud på truncus, nodulært 01-04-2006 31-12-2011
DC435H Malignt melanom i hud på truncus, akralt lentiginøst 01-04-2006 31-12-2011
DC435J Malignt melanom i hud på truncus, malignt blue naevus 01-04-2006 31-12-2011
DC435K Malignt melanom i hud på truncus, desmoplastisk 01-04-2006 31-12-2011
DC435L Malignt melanom i anale marginalzone 01-01-2012
DC435M Malignt melanom i hud på kroppen med metastaser 01-01-2012 31-12-2021
DC435Z Malignt melanom i hud på truncus, andet 01-04-2006 31-12-2011
DC436 Malignt melanom i hud på overekstremitet 01-01-1994
DC436A Malignt melanom i hud på skulder 01-01-1994
DC436B Malignt melanom i hud på arm 01-01-1994
DC436C Malignt melanom i hud på hånd eller finger 01-01-2002
DC436E Malignt melanom i hud på overekstremitet, lentigo maligna 01-04-2006 31-12-2011
DC436F Malignt melanom i hud på overekstremitet, superfic. spred 01-04-2006 31-12-2011
DC436G Malignt melanom i hud på overekstremitet, nodulært 01-04-2006 31-12-2011
DC436H Malignt melanom i hud på overekstremitet, akralt lentiginøst 01-04-2006 31-12-2011
DC436J Malignt melanom i hud på overekstremit, malignt blue naevus 01-04-2006 31-12-2011
DC436K Malignt melanom i hud på overekstremitet, desmoplastisk 01-04-2006 31-12-2011
DC436M Malignt melanom i hud på overekstremitet med metastaser 01-01-2017 31-12-2021
DC436Z Malignt melanom i hud på overekstremitet, andet 01-04-2006 31-12-2011
DC437 Malignt melanom i hud på underekstremitet 01-01-1994
DC437A Malignt melanom i hud på ben 01-01-1994
DC437B Malignt melanom i hud på hofte 01-01-1994
DC437C Malignt melanom i hud på fod eller tå 01-01-2002
DC437E Malignt melanom i hud på underekstremitet, lentigo maligna 01-04-2006 31-12-2011
DC437F Malignt melanom i hud på underekstremitet, superfic. spred 01-04-2006 31-12-2011
DC437G Malignt melanom i hud på underekstremitet, nodulært 01-04-2006 31-12-2011
DC437H Malignt melanom i hud på underekstremit, akralt lentiginøst 01-04-2006 31-12-2011
DC437J Malignt melanom i hud på underekstremit, malignt blue naevus 01-04-2006 31-12-2011
DC437K Malignt melanom i hud på underekstremitet, desmoplastisk 01-04-2006 31-12-2011
DC437M Malignt melanom i hud på underekstremitet med metastaser 01-01-2017 31-12-2021
DC437Z Malignt melanom i hud på underekstremitet, anden type 01-04-2006 31-12-2011
DC438 Malignt melanom overgribende flere lokalisationer 01-01-1994
DC438E Malignt melanom i hud overgr flere regioner, lentigo maligna 01-04-2006 31-12-2011
DC438F Malignt melanom i hud overgrib flere regioner, superf.spred 01-04-2006 31-12-2011
DC438G Malignt melanom i hud overgrib flere regioner, nodulært 01-04-2006 31-12-2011
DC438H Malignt melanom i hud overgr.fl.regioner, akralt lentiginøst 01-04-2006 31-12-2011
DC438J Malignt melanom i hud overgrib fl.reg, malignt blue naevus 01-04-2006 31-12-2011
DC438K Malignt melanom i hud overgrib flere regioner, desmoplastisk 01-04-2006 31-12-2011
DC438M Malignt melanom overgribende flere lokalisation m metastaser 01-01-2017 31-12-2021
DC438Z Malignt melanom i hud overgrib flere regioner, anden type 01-04-2006 31-12-2011
DC439 Malignt melanom i huden UNS 01-01-1994
DC439E Malignt melanom i hud uden spec, lentigo maligna 01-04-2006 31-12-2011
DC439F Malignt melanom i hud uden spec, superfic. spredende 01-04-2006 31-12-2011
DC439G Malignt melanom i hud uden spec, nodulært 01-04-2006 31-12-2011
DC439H Malignt melanom i hud uden spec, akralt lentiginøst 01-04-2006 31-12-2011
DC439J Malignt melanom i hud uden spec, malignt blue naevus 01-04-2006 31-12-2011
DC439K Malignt melanom i hud uden spec, desmoplastisk 01-04-2006 31-12-2011
DC439M Malignt melanom i huden med metastaser 01-01-2017 31-12-2021
DC439X Lokalrecidiv fra malignt melanom i huden 01-04-2012 31-12-2021
DC439Z Malignt melanom i hud uden spec, anden type 01-04-2006 31-12-2011
DC44 Anden hudkræft 01-01-1994
DC440 Anden hudkræft på læbe 01-01-1994
DC440D Hudkræft i læbe, basocellulær, nodulært 01-04-2006 31-12-2011
DC440E Hudkræft i læbe, basocellulær, superficielt 01-04-2006 31-12-2011
DC440F Hudkræft i læbe, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC440G Hudkræft i læbe, basocellulær, multiplex 01-04-2006 31-12-2011
DC440H Hudkræft i læbe, basocellulær, recidiverende 01-04-2006 31-12-2011
DC440J Hudkræft i læbe, planocellulær, verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC440K Hudkræft i læbe, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC440L Hudkræft i læbe, planocellulær, Marjorlin/Melaney 01-04-2006 31-12-2011
DC440M Anden hudkræft på læbe med metastaser 01-04-2006 31-12-2021
DC440N Hudkræft i læbe, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC440P Hudkræft i læbe, Merkelcelle karcinom 01-04-2006 31-12-2011
DC440Q Hudkræft i læbe, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC440R Hudkræft i læbe, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC440S Hudkræft i læbe, porokarcinom 01-04-2006 31-12-2011
DC440T Hudkræft i læbe, sebaceøst karcinom 01-04-2006 31-12-2011
DC440U Hudkræft i læbe, trichillemmalt karcinom 01-04-2006 31-12-2011
DC440V Hudkræft i læbe, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC440W Hudkræft i læbe, angiosarkom 01-04-2006 31-12-2011
DC440Z Hudkræft i læbe, anden type 01-04-2006 31-12-2011
DC441 Anden hudkræft på øjenlåg 01-01-1994
DC441A Anden hudkræft i øjenkrog 01-01-1994
DC441B Hudkræft i øjenlåg uden specifikation 01-01-1994 31-12-2011
DC441D Hudkræft i øjenlåg, basocellulær, nodulært 01-04-2006 31-12-2011
DC441E Hudkræft i øjenlåg, basocellulær, superficielt 01-04-2006 31-12-2011
DC441F Hudkræft i øjenlåg, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC441G Hudkræft i øjenlåg, basocellulær, multiplex 01-04-2006 31-12-2011
DC441H Hudkræft i øjenlåg, basocellulær, recidiverende 01-04-2006 31-12-2011
DC441J Hudkræft i øjenlåg, planocellulær, verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC441K Hudkræft i øjenlåg, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC441L Hudkræft i øjenlåg, planocellulær, Marjorlin/Melaney 01-04-2006 31-12-2011
DC441M Anden hudkræft på øjenlåg med metastaser 01-04-2006 31-12-2021
DC441N Hudkræft i øjenlåg, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC441P Hudkræft i øjenlåg, Merkelcelle karcinom 01-04-2006 31-12-2011
DC441Q Hudkræft i øjenlåg, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC441R Hudkræft i øjenlåg, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC441S Hudkræft i øjenlåg, porokarcinom 01-04-2006 31-12-2011
DC441T Hudkræft i øjenlåg, sebaceøst karcinom 01-04-2006 31-12-2011
DC441U Hudkræft i øjenlåg, trichillemmalt karcinom 01-04-2006 31-12-2011
DC441V Hudkræft i øjenlåg, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC441W Hudkræft i øjenlåg, angiosarkom 01-04-2006 31-12-2011
DC441Z Hudkræft i øjenlåg, anden type 01-04-2006 31-12-2011
DC442 Anden hudkræft på øre eller i ydre øregang 01-01-1994
DC442A Anden hudkræft på øre 01-01-1994
DC442B Anden hudkræft i ydre øregang 01-01-1994
DC442C Hudkræft i meatus acusticus externus uden specifikation 01-01-1994 31-12-2011
DC442D Hudkræft i ydre øre, basocellulær, nodulært 01-04-2006 31-12-2011
DC442E Hudkræft i ydre øre, basocellulær, superficielt 01-04-2006 31-12-2011
DC442F Hudkræft i ydre øre, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC442G Hudkræft i ydre øre, basocellulær, multiplex 01-04-2006 31-12-2011
DC442H Hudkræft i ydre øre, basocellulær, recidiverende 01-04-2006 31-12-2011
DC442J Hudkræft i ydre øre, planocellulær, verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC442K Hudkræft i ydre øre, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC442L Hudkræft i ydre øre, planocellulær, Marjorlin/Melaney 01-04-2006 31-12-2011
DC442M Anden hudkræft på øre eller i ydre øregang med metastaser 01-04-2006 31-12-2021
DC442N Hudkræft i ydre øre, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC442P Hudkræft i ydre øre, Merkelcelle karcinom 01-04-2006 31-12-2011
DC442Q Hudkræft i ydre øre, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC442R Hudkræft i ydre øre, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC442S Hudkræft i ydre øre, porokarcinom 01-04-2006 31-12-2011
DC442T Hudkræft i ydre øre, sebaceøst karcinom 01-04-2006 31-12-2011
DC442U Hudkræft i ydre øre, trichillemmalt karcinom 01-04-2006 31-12-2011
DC442V Hudkræft i ydre øre, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC442W Hudkræft i ydre øre, angiosarkom 01-04-2006 31-12-2011
DC442Z Hudkræft i ydre øre, anden type 01-04-2006 31-12-2011
DC443 Anden hudkræft i ansigtet med anden/ikke spec. lokalisation 01-01-1994
DC443A Hudkræft i ansigt, an/uspec, uden specifikation 01-01-1994 31-12-2011
DC443D Hudkræft i ansigt, an/uspec, basocellulær, nodulært 01-04-2006 31-12-2011
DC443E Hudkræft i ansigt, an/uspec, basocellulær, superficielt 01-04-2006 31-12-2011
DC443F Hudkræft i ansigt, an/uspec, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC443G Hudkræft i ansigt, an/uspec, basocellulær, multiplex 01-04-2006 31-12-2011
DC443H Hudkræft i ansigt, an/uspec, basocellulær, recidiverende 01-04-2006 31-12-2011
DC443J Hudkræft i ansigt, an/uspec, planocell, verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC443K Hudkræft i ansigt, an/uspec, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC443L Hudkræft i ansigt, an/uspec, planocell, Marjorlin/Melaney 01-04-2006 31-12-2011
DC443M Anden hudkræft i ansigtet med metastaser 01-04-2006 31-12-2021
DC443N Hudkræft i ansigt, an/uspec, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC443P Hudkræft i ansigt, an/uspec, Merkelcelle karcinom 01-04-2006 31-12-2011
DC443Q Hudkræft i ansigt, an/uspec, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC443R Hudkræft i ansigt, an/uspec, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC443S Hudkræft i ansigt, an/uspec, porokarcinom 01-04-2006 31-12-2011
DC443T Hudkræft i ansigt, an/uspec, sebaceøst karcinom 01-04-2006 31-12-2011
DC443U Hudkræft i ansigt, an/uspec, trichillemmalt karcinom 01-04-2006 31-12-2011
DC443V Hudkræft i ansigt, an/uspec, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC443W Hudkræft i ansigt, an/uspec, angiosarkom 01-04-2006 31-12-2011
DC443Z Hudkræft i ansigt, an/uspec, anden type 01-04-2006 31-12-2011
DC444 Anden hudkræft på skalpen eller halsen 01-01-1994
DC444A Anden hudkræft på skalpen 01-01-1994
DC444B Anden hudkræft på halsen 01-01-1994
DC444D Hudkræft på skalp og hals, basocellulær, nodulært 01-04-2006 31-12-2011
DC444E Hudkræft på skalp og hals, basocellulær, superfic. 01-04-2006 31-12-2011
DC444F Hudkræft på skalp og hals, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC444G Hudkræft på skalp og hals, basocellulær, multiplex 01-04-2006 31-12-2011
DC444H Hudkræft på skalp og hals, basocellulær, recidiverende 01-04-2006 31-12-2011
DC444J Hudkræft på skalp og hals, planocell, verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC444K Hudkræft på skalp og hals, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC444L Hudkræft på skalp og hals, planocellulær, Marjorlin/Melaney 01-04-2006 31-12-2011
DC444M Anden hudkræft på skalpen eller halsen med metastaser 01-04-2006 31-12-2021
DC444N Hudkræft på skalp og hals, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC444P Hudkræft på skalp og hals, Merkelcelle karcinom 01-04-2006 31-12-2011
DC444Q Hudkræft på skalp og hals, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC444R Hudkræft på skalp og hals, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC444S Hudkræft på skalp og hals, porokarcinom 01-04-2006 31-12-2011
DC444T Hudkræft på skalp og hals, sebaceøst karcinom 01-04-2006 31-12-2011
DC444U Hudkræft på skalp og hals, trichillemmalt karcinom 01-04-2006 31-12-2011
DC444V Hudkræft på skalp og hals, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC444W Hudkræft på skalp og hals, angiosarkom 01-04-2006 31-12-2011
DC444Z Hudkræft på skalp og hals, anden type 01-04-2006 31-12-2011
DC445 Anden hudkræft på kroppen 01-01-1994
DC445A Anden hudkræft i anus 01-01-1994
DC445B Anden hudkræft på bryst 01-01-1994
DC445C Anden hudkræft i perineum 01-01-1994
DC445D Hudkræft på truncus, basocellulær, nodulært 01-04-2006 31-12-2011
DC445E Hudkræft på truncus, basocellulær, superfic. 01-04-2006 31-12-2011
DC445F Hudkræft på truncus, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC445G Hudkræft på truncus, basocellulær, multiplex 01-04-2006 31-12-2011
DC445H Hudkræft på truncus, basocellulær, recidiverende 01-04-2006 31-12-2011
DC445J Hudkræft på truncus, planocellulær, verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC445K Hudkræft på truncus, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC445L FEJLOPRETTET 01-04-2006 01-01-2012
DC445M Anden hudkræft på kroppen med metastaser 01-04-2006 31-12-2021
DC445N Hudkræft på truncus, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC445P Hudkræft på truncus, Merkelcelle karcinom 01-04-2006 31-12-2011
DC445Q Hudkræft på truncus, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC445R Hudkræft på truncus, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC445S Hudkræft på truncus, porokarcinom 01-04-2006 31-12-2011
DC445T Hudkræft på truncus, sebaceøst karcinom 01-04-2006 31-12-2011
DC445U Hudkræft på truncus, trichillemmalt karcinom 01-04-2006 31-12-2011
DC445V Hudkræft på truncus, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC445W Hudkræft på truncus, angiosarkom 01-04-2006 31-12-2011
DC445Z Hudkræft på truncus, anden type 01-04-2006 31-12-2011
DC446 Anden hudkræft på overekstremitet 01-01-1994
DC446A Anden hudkræft på skulder 01-01-1994
DC446B Anden hudkræft på arm 01-01-1994
DC446C Anden hudkræft på hånd eller finger 01-01-2002
DC446D Hudkræft på overekstremitet, basocellulær, nodulært 01-04-2006 31-12-2011
DC446E Hudkræft på overekstremitet, basocellulær, superficielt 01-04-2006 31-12-2011
DC446F Hudkræft på overekstremitet, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC446G Hudkræft på overekstremitet, basocellulær, multiplex 01-04-2006 31-12-2011
DC446H Hudkræft på overekstremitet, basocellulær, recidiverende 01-04-2006 31-12-2011
DC446J Hudkræft på overekstremitet, planocell, verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC446K Hudkræft på overekstremitet, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC446L Hudkræft på overekstremitet, planocell, Marjorlin/Melaney 01-04-2006 31-12-2011
DC446M Anden hudkræft på overekstremitet med metastaser 01-04-2006 31-12-2021
DC446N Hudkræft på overekstremitet, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC446P Hudkræft på overekstremitet, Merkelcelle karcinom 01-04-2006 31-12-2011
DC446Q Hudkræft på overekstremitet, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC446R Hudkræft på overekstremitet, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC446S Hudkræft på overekstremitet, porokarcinom 01-04-2006 31-12-2011
DC446T Hudkræft på overekstremitet, sebaceøst karcinom 01-04-2006 31-12-2011
DC446U Hudkræft på overekstremitet, trichillemmalt karcinom 01-04-2006 31-12-2011
DC446V Hudkræft på overekstremitet, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC446W Hudkræft på overekstremitet, angiosarkom 01-04-2006 31-12-2011
DC446Z Hudkræft på overekstremitet, anden type 01-04-2006 31-12-2011
DC447 Anden hudkræft på underekstremitet 01-01-1994
DC447A Anden hudkræft på hofte 01-01-1994
DC447B Anden hudkræft på ben 01-01-1994
DC447C Anden hudkræft på fod eller tå 01-01-2002
DC447D Hudkræft på underekstremitet, basocellulær, nodulært 01-04-2006 31-12-2011
DC447E Hudkræft på underekstremitet, basocellulær, superficielt 01-04-2006 31-12-2011
DC447F Hudkræft på underekstremitet, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC447G Hudkræft på underekstremitet, basocellulær, multiplex 01-04-2006 31-12-2011
DC447H Hudkræft på underekstremitet, basocellulær, recidivans 01-04-2006 31-12-2011
DC447J Hudkræft på underekstremitet, planocell,verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC447K Hudkræft på underekstremitet, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC447L Hudkræft på underekstremitet, planocell, Marjorlin/Melaney 01-04-2006 31-12-2011
DC447M Anden hudkræft på underekstremitet med metastaser 01-04-2006 31-12-2021
DC447N Hudkræft på underekstremitet, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC447P Hudkræft på underekstremitet, Merkelcelle karcinom 01-04-2006 31-12-2011
DC447Q Hudkræft på underekstremitet, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC447R Hudkræft på underekstremitet, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC447S Hudkræft på underekstremitet, porokarcinom 01-04-2006 31-12-2011
DC447T Hudkræft på underekstremitet, sebaceøst karcinom 01-04-2006 31-12-2011
DC447U Hudkræft på underekstremitet, trichillemmalt karcinom 01-04-2006 31-12-2011
DC447V Hudkræft på underekstremit, dermatofibrosarcoma protuberans 01-04-2006 31-12-2011
DC447W Hudkræft på underekstremitet, angiosarkom 01-04-2006 31-12-2011
DC447Z Hudkræft på underekstremitet, anden type 01-04-2006 31-12-2011
DC448 Anden hudkræft overgribende flere lokalisationer 01-01-1994
DC448D Hudkræft overgrib. flere regioner, basocellulær, nodulært 01-04-2006 31-12-2011
DC448E Hudkræft overgrib. flere reg, basocellulær, superficielt 01-04-2006 31-12-2011
DC448F Hudkræft overgrib. flere reg, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC448G Hudkræft overgrib. flere regioner, basocellulær, multiplex 01-04-2006 31-12-2011
DC448H Hudkræft overgrib. flere regioner, basocellulær, recidivans 01-04-2006 31-12-2011
DC448J Hudkræft overgrib. flere reg, planocell,verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC448K Hudkræft overgrib. flere reg, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC448L Hudkræft overgrib. flere reg, planocell, Marjorlin/Melaney 01-04-2006 31-12-2011
DC448M Anden hudkræft overgrib. flere lokalisationer med metastaser 01-04-2006 31-12-2021
DC448N Hudkræft overgrib. flere reg, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC448P Hudkræft overgrib. flere regioner, Merkelcelle karcinom 01-04-2006 31-12-2011
DC448Q Hudkræft overgrib. flere regioner, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC448R Hudkræft overgrib. flere regioner, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC448S Hudkræft overgrib. flere regioner, porokarcinom 01-04-2006 31-12-2011
DC448T Hudkræft overgrib. flere regioner, sebaceøst karcinom 01-04-2006 31-12-2011
DC448U Hudkræft overgrib. flere regioner, trichillemmalt karcinom 01-04-2006 31-12-2011
DC448V Hudkræft overgrib. flere reg, dermatofibrosarcoma protuber. 01-04-2006 31-12-2011
DC448W Hudkræft overgrib. flere regioner, angiosarkom 01-04-2006 31-12-2011
DC448Z Hudkræft overgrib. flere regioner, anden type 01-04-2006 31-12-2011
DC449 Anden hudkræft UNS 01-01-1994
DC449D Hudkræft uden specifikation, basocellulær, nodulært 01-04-2006 31-12-2011
DC449E Hudkræft uden specifikation, basocellulær, superficielt 01-04-2006 31-12-2011
DC449F Hudkræft uden specifikation, basocellulær, morphaeatype 01-04-2006 31-12-2011
DC449G Hudkræft uden specifikation, basocellulær, multiplex 01-04-2006 31-12-2011
DC449H Hudkræft uden specifikation, basocellulær, recidivans 01-04-2006 31-12-2011
DC449J Hudkræft uden specifikation, planocell,verrukøst (cun, B-L) 01-04-2006 31-12-2011
DC449K Hudkræft uden specifikation, planocellulær, spinocellulært 01-04-2006 31-12-2011
DC449L Hudkræft uden specifikation, planocell, Marjorlin/Melaney 01-04-2006 31-12-2011
DC449M Anden hudkræft med metastaser 01-04-2006 31-12-2021
DC449N Hudkræft uden specifikation, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC449P Hudkræft uden specifikation, Merkelcelle karcinom 01-04-2006 31-12-2011
DC449Q Hudkræft uden specifikation, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC449R Hudkræft uden specifikation, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC449S Hudkræft uden specifikation, porokarcinom 01-04-2006 31-12-2011
DC449T Hudkræft uden specifikation, sebaceøst karcinom 01-04-2006 31-12-2011
DC449U Hudkræft uden specifikation, trichillemmalt karcinom 01-04-2006 31-12-2011
DC449V Hudkræft uden specifikation, dermatofibrosarcoma protuber. 01-04-2006 31-12-2011
DC449W Hudkræft uden specifikation, angiosarkom 01-04-2006 31-12-2011
DC449X Lokalrecidiv fra anden hudkræft 01-04-2012 31-12-2021
DC449Z Hudkræft uden specifikation, anden type 01-04-2006 31-12-2011
DC45 Maligne mesoteliomer 01-01-1994
DC450 Malignt mesoteliom i lungehinde 01-01-1994
DC450M Malignt mesoteliom i lungehinde med metastaser 01-01-2017 31-12-2021
DC451 Malignt mesoteliom i bughinden 01-01-1994
DC451M Malignt mesoteliom i bughinden med metastaser 01-01-2017 31-12-2021
DC452 Malignt mesoteliom i perikardiet 01-01-1994
DC452M Malignt mesoteliom i perikardiet med metastaser 01-01-2017 31-12-2021
DC457 Malignt mesoteliom med anden lokalisation 01-01-1994
DC457M Malignt mesoteliom med anden lokalisation med metastaser 01-01-2017 31-12-2021
DC459 Malignt mesoteliom UNS 01-01-1994
DC459M Malignt mesoteliom med metastaser 01-01-2017 31-12-2021
DC459X Lokalrecidiv fra malignt mesoteliom 01-04-2012 31-12-2021
DC46 Kaposis sarkom 01-01-1994
DC460 Kaposis sarkom i huden 01-01-1994
DC460M Kaposis sarkom i huden med metastaser 01-01-2017 31-12-2021
DC461 Kaposis sarkom i bindevæv 01-01-1994
DC461M Kaposis sarkom i bindevæv med metastaser 01-01-2017 31-12-2021
DC462 Kaposis sarkom i ganen 01-01-1994
DC462M Kaposis sarkom i ganen med metastaser 01-01-2017 31-12-2021
DC463 Kaposis sarkom i lymfeknuder 01-01-1994
DC463M Kaposis sarkom i lymfeknuder med metastaser 01-01-2017 31-12-2021
DC467 Kaposis sarkom med anden lokalisation 01-01-1994
DC467M Kaposis sarkom med anden lokalisation med metastaser 01-01-2017 31-12-2021
DC468 Kaposis sarkom i multiple lokalisationer 01-01-1994
DC468M Kaposis sarkom i multiple lokalisationer med metastaser 01-01-2017 31-12-2021
DC469 Kaposis sarkom UNS 01-01-1994
DC469M Kaposis sarkom med metastaser 01-01-2017 31-12-2021
DC469X Lokalrecidiv fra Kaposis sarkom 01-04-2012 31-12-2021
DC47 Kræft i perifere nerver og autonome nervesystem 01-01-1994
DC470 Kræft i perifer nerve el. auton.NS i hoved, ansigt el. hals 01-01-1994
DC470A Kræft i perifer nerve i hovedet 01-01-1994
DC470B Kræft i perifer nerve i halsen 01-01-1994
DC470C Kræft i perifer nerve i ansigtet 01-01-1994
DC470D Kræft i autonome nervesystem i hovedet 01-01-1994
DC470E Kræft i autonome nervesystem i halsen 01-01-1994
DC470F Kræft i autonome nervesystem i ansigtet 01-01-1994
DC470M Kræft i perif.nerve/auton.NS i hoved/ansigt/hals m.metastase 01-01-2017 31-12-2021
DC471 Kræft i perifer nerve eller autonome nervesystem i arm 01-01-1994
DC471A Kræft i perifer nerve i skulderregion 01-01-1994
DC471B Kræft i perifer nerve i arm eller hånd 01-01-1994
DC471C Kræft i autonome nervesystem i skulderregion 01-01-1994
DC471D Kræft i autonome nervesystem i arm eller hånd 01-01-1994
DC471M Kræft i perifer nerve/autonome NS i arm med metastaser 01-01-2017 31-12-2021
DC472 Kræft i perifer nerve eller autonome nervesystem i ben 01-01-1994
DC472A Kræft i perifer nerve i hofteregion 01-01-1994
DC472B Kræft i perifer nerve i ben eller fod 01-01-1994
DC472C Kræft i autonome nervesystem i hofteregion 01-01-1994
DC472D Kræft i autonome nervesystem i ben eller fod 01-01-1994
DC472M Kræft i perifer nerve/autonome NS i ben med metastaser 01-01-2017 31-12-2021
DC473 Kræft i perifer nerve eller autonome nervesystem i thorax 01-01-1994
DC473A Kræft i perifer nerve i thorax 01-01-1994
DC473B Kræft i autonome nervesystem i thorax 01-01-1994
DC473M Kræft i perifer nerve/autonome NS i thorax med metastaser 01-01-2017 31-12-2021
DC474 Kræft i perifer nerve eller autonome nervesystem i abdomen 01-01-1994
DC474A Kræft i perifer nerve i abdomen 01-01-1994
DC474B Kræft i autonome nervesystem i abdomen 01-01-1994
DC474M Kræft i perifer nerve/autonome NS i abdomen med metastaser 01-01-2017 31-12-2021
DC475 Kræft i perifer nerve eller autonome nervesystem i bækkenet 01-01-1994
DC475A Kræft i perifer nerve i bækkenet 01-01-1994
DC475B Kræft i autonome nervesystem i bækkenet 01-01-1994
DC475M Kræft i perifer nerve/autonome NS i bækkenet med metastaser 01-01-2017 31-12-2021
DC476 Kræft i perifer nerve el. autonome nervesystem i truncus UNS 01-01-1994
DC476A Kræft i perifer nerve i truncus 01-01-1994
DC476B Kræft i autonome nervesystem i truncus 01-01-1994
DC476M Kræft i perifer nerve/autonome NS i truncus med metastaser 01-01-2017 31-12-2021
DC478 Kræft i perifere nerver el. auton.NS overgribende fl. lokal. 01-01-1994
DC478A Kræft i perifere nerver overgribende flere lokalisationer 01-01-1994
DC478B Kræft i auton.NS overgrib.fl.lokal. 01-01-1994
DC478M Kræft i perif.nerve/auton.NS overgrib. fl.lokal. m metastase 01-01-2017 31-12-2021
DC479 Kræft i perifer nerve eller autonome nervesystem UNS 01-01-1994
DC479A Kræft i perifer nerve UNS 01-01-1994
DC479B Kræft i autonome nervesystem UNS 01-01-1994
DC479M Kræft i perifer nerve/autonome nervesystem med metastaser 01-01-2017 31-12-2021
DC479X Lokalrecidiv fra kræft i perifer nerve/autonome nervesystem 01-04-2012 31-12-2021
DC48 Kræft i bughinden og i bughulens bagvæg 01-01-1994
DC480 Kræft i retroperitoneum 01-01-1994
DC480M Kræft i retroperitoneum med metastaser 01-01-2017 31-12-2021
DC480X Lokalrecidiv fra kræft i retroperitoneum 01-04-2012 31-12-2021
DC481 Kræft i spec. del af peritoneum 01-01-1994
DC481A Kræft i mesenteriet 01-01-1994
DC481B Kræft i mesocolon 01-01-1994
DC481C Kræft i oment 01-01-1994
DC481M Kræft i spec. del af peritoneum med metastaser 01-01-2017 31-12-2021
DC482 Kræft i peritoneum UNS 01-01-1994
DC482M Kræft i peritoneum med metastaser 01-01-2017 31-12-2021
DC482X Lokalrecidiv fra kræft i peritoneum 01-04-2012 31-12-2021
DC488 Kræft i bughinden og bughulens bagvæg overgrib.fl.lokal. 01-01-1994
DC488M Kræft i bughind/bughulebagvæg overgrib.fl.lokal. m.metastase 01-01-2017 31-12-2021
DC49 Kræft i andet bindevæv og bløddelsvæv 01-01-1994
DC490 Kræft i bindevæv og bløddelsvæv i hoved, ansigt eller hals 01-01-1994
DC490A Kræft i bindevæv og bløddelsvæv i hovedet 01-01-1994
DC490B Kræft i bindevæv og bløddelsvæv i halsen 01-01-1994
DC490C Kræft i bindevæv og bløddelsvæv i ansigtet 01-01-1994
DC490M Kræft i bindevæv/bløddelsvæv i hoved/ansigt/hals m.metastase 01-01-2017 31-12-2021
DC491 Kræft i bindevæv og bløddelsvæv i overekstremitet 01-01-1994
DC491A Kræft i bindevæv og bløddelsvæv i skulderregion 01-01-1994
DC491B Kræft i bindevæv og bløddelsvæv i arm 01-01-1994
DC491M Kræft i bindevæv/bløddelsvæv i overekstremitet med metastase 01-01-2017 31-12-2021
DC492 Kræft i bindevæv og bløddelsvæv i underekstremitet 01-01-1994
DC492A Kræft i bindevæv og bløddelsvæv i ben 01-01-1994
DC492B Kræft i bindevæv og bløddelsvæv i hofteregion 01-01-1994
DC492M Kræft i bindevæv/bløddelsvæv i underekstremitet m.metastase 01-01-2017 31-12-2021
DC493 Kræft i bindevæv og bløddelsvæv i thorax 01-01-1994
DC493A Kræft i bindevæv og bløddelsvæv i armhule 01-01-1994
DC493B Kræft i bindevæv og bløddelsvæv i mellemgulvet 01-01-1994
DC493C Neopl mal telae conjunctivae thoracis 01-01-1994 18-07-1996
DC493M Kræft i bindevæv/bløddelsvæv i thorax med metastaser 01-01-2017 31-12-2021
DC494 Kræft i bindevæv og bløddelsvæv i abdomen 01-01-1994
DC494M Kræft i bindevæv/bløddelsvæv i abdomen med metastaser 01-01-2017 31-12-2021
DC495 Kræft i bindevæv og bløddelsvæv i bækkenet 01-01-1994
DC495A Kræft i bindevæv og bløddelsvæv i perineum 01-01-1994
DC495M Kræft i bindevæv/bløddelsvæv i bækkenet med metastaser 01-01-2017 31-12-2021
DC496 Kræft i bindevæv og bløddelsvæv i truncus UNS 01-01-1994
DC496M Kræft i bindevæv/bløddelsvæv i truncus med metastaser 01-01-2017 31-12-2021
DC498 Kræft i bindevæv og bløddelsvæv overgrib.fl.lokal. 01-01-1994
DC498A Malignt fibrøst histiocytom 01-04-2000 31-12-2011
DC498M Kræft i bindevæv/bløddelsvæv overgrib.fl.lokal. m.metastaser 01-01-2017 31-12-2021
DC499 Kræft i bindevæv og bløddelsvæv UNS 01-01-1994
DC499M Kræft i bindevæv/bløddelsvæv med metastaser 01-01-2017 31-12-2021
DC499X Lokalrecidiv fra kræft i bindevæv og bløddelsvæv 01-04-2012 31-12-2021
DC50 Brystkræft 01-01-1994
DC500 Kræft i brystvorte eller areola mammae 01-01-1994
DC500A Kræft i areolae mammae 01-01-1994
DC500B Kræft i brystvorte 01-01-1994
DC500C Paget's sygdom i mamma 01-04-2000 30-09-2010
DC500D Paget's disease of the nipple 01-10-2004 30-09-2010
DC500M Kræft i brystvorte eller areola mammae med metastaser 01-01-2017 31-12-2021
DC501 Brystkræft i den centrale del af mamma 01-01-1994
DC501M Brystkræft i centrale del af mamma med metastaser 01-01-2017 31-12-2021
DC502 Brystkræft i den øvre mediale kvadrant af mamma 01-01-1994
DC502M Brystkræft i øvre mediale kvadrant af mamma med metastaser 01-01-2017 31-12-2021
DC503 Brystkræft i den nedre mediale kvadrant af mamma 01-01-1994
DC503M Brystkræft i nedre mediale kvadrant af mamma med metastaser 01-01-2017 31-12-2021
DC504 Brystkræft i den øvre laterale kvadrant af mamma 01-01-1994
DC504M Brystkræft i øvre laterale kvadrant af mamma med metastaser 01-01-2017 31-12-2021
DC505 Brystkræft i den nedre laterale kvadrant af mamma 01-01-1994
DC505M Brystkræft i nedre laterale kvadrant af mamma m.metastaser 01-01-2017 31-12-2021
DC506 Brystkræft i processus axillaris mammae 01-01-1994
DC506M Brystkræft i processus axillaris mammae med metastaser 01-01-2017 31-12-2021
DC508 Brystkræft overgribende flere lokalisationer 01-01-1994
DC508M Brystkræft overgribende flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC509 Brystkræft UNS 01-01-1994
DC509M Brystkræft med metastaser 01-01-2017 31-12-2021
DC509X Lokalrecidiv fra brystkræft 01-04-2012 31-12-2021
DC51 Kræft i ydre kvindelige kønsorganer 01-01-1994
DC510 Kræft i stor kønslæbe 01-01-1994
DC510A Kræft i Bartholins kirtel 01-01-1994
DC510M Kræft i stor kønslæbe med metastaser 01-01-2017 31-12-2021
DC511 Kræft i lille kønslæbe 01-01-1994
DC511M Kræft i lille kønslæbe med metastaser 01-01-2017 31-12-2021
DC512 Kræft i klitoris 01-01-1994
DC512M Kræft i klitoris med metastaser 01-01-2017 31-12-2021
DC518 Kræft i ydre kvind. kønsorganer overgrib.fl.lokal. 01-01-1994
DC518M Kræft i ydre kvind.kønsorgan overgrib.fl.lokal. m.metastaser 01-01-2017 31-12-2021
DC519 Kræft i ydre kvindelige kønsorganer UNS 01-01-1994
DC519D Neoplasma malignum vulvae non spec, basocellulært, nodulært 01-04-2006 31-12-2011
DC519E Neopl. malign. vulvae non spec, basocellulært, superficielt 01-04-2006 31-12-2011
DC519F Neopl. malign. vulvae non spec, basocellulært, morphaeatype 01-04-2006 31-12-2011
DC519G Neoplasma malignum vulvae non spec, basocellulært, multiplex 01-04-2006 31-12-2011
DC519H Neopl. malign. vulvae non spec, basocellulært, recidivans 01-04-2006 31-12-2011
DC519J Ne mal vulvae non spec, plan, verr (cun, B-L) 01-04-2006 31-12-2011
DC519K Neopl. malign. vulvae non spec, planocellulært, spinocel. 01-04-2006 31-12-2011
DC519L Ne mal vulvae non spec, planocellulært, Marjorlin/Melaney 01-04-2006 31-12-2011
DC519M Kræft i ydre kvindelige kønsorganer med metastaser 01-04-2006 31-12-2021
DC519N Neopl. malign. vulvae non spec, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC519P Neoplasma malignum vulvae non spec, Merkelcelle karcinom 01-04-2006 31-12-2011
DC519Q Neopl. malign. vulvae non spec, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC519R Neopl. malign. vulvae non spec, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC519S Neoplasma malignum vulvae non spec, porokarcinom 01-04-2006 31-12-2011
DC519T Neoplasma malignum vulvae non spec, sebaceøst karcinom 01-04-2006 31-12-2011
DC519U Neoplasma malignum vulvae non spec, trichillemmalt karcinom 01-04-2006 31-12-2011
DC519V Neopl. malign. vulvae non spec, dermatofibrosarc. prot. 01-04-2006 31-12-2011
DC519W Neoplasma malignum vulvae non spec, angiosarkom 01-04-2006 31-12-2011
DC519X Lokalrecidiv fra kræft i ydre kvindelige kønsorganer 01-04-2012 31-12-2021
DC519Z Neoplasma malignum vulvae non spec, andet 01-04-2006 31-12-2011
DC52 Kræft i vagina 01-01-1994
DC529 Vaginakræft 01-01-1994
DC529M Vaginakræft med metastaser 01-01-2017 31-12-2021
DC529X Lokalrecidiv fra vaginakræft 01-04-2012 31-12-2021
DC53 Kræft i livmoderhalsen 01-01-1994
DC530 Neopl mal endocervicis uteri 01-01-1994 31-12-2005
DC531 Neopl mal cervicis uteri, planocellulært carcinom st. I 01-01-1994 31-12-2005
DC532 Neopl mal cervicis uteri, planocellulært carcinom st. II 01-01-1994 31-12-2005
DC533 Neopl mal cervicis uteri, planocellulært carcinom st. III 01-01-1994 31-12-2005
DC534 Neopl mal cervicis uteri, planocellulært carcinom st. IV 01-01-1994 31-12-2005
DC538 Neopl mal cervicis uteri overgribende flere regioner 01-01-1994 31-12-2005
DC539 Livmoderhalskræft 01-01-1994
DC539M Livmoderhalskræft med metastaser 01-01-2017 31-12-2021
DC539X Lokalrecidiv fra livmoderhalskræft 01-04-2012 31-12-2021
DC54 Kræft i livmoderen 01-01-1994
DC540 Neopl mal isthmi uteri, st. I 01-01-1994 31-12-2005
DC541 Neopl mal fundi uteri, st. I 01-01-1994 31-12-2005
DC542 Neopl mal myometrii, alle stadier 01-01-1994 31-12-2005
DC543 Neopl mal endometrii, st. I 01-01-1994 31-12-2005
DC544 Neopl mal endometrii, st. II 01-01-1994 31-12-2005
DC545 Neopl mal endometrii, st. III 01-01-1994 31-12-2005
DC546 Neopl mal endometrii, st. IV 01-01-1994 31-12-2005
DC548 Neopl mal corporis uteri overgribende flere regioner 01-01-1994 31-12-2005
DC549 Livmoderkræft 01-01-1994
DC549M Livmoderkræft med metastaser 01-01-2017 31-12-2021
DC549X Lokalrecidiv fra livmoderkræft 01-04-2012 31-12-2021
DC55 Kræft i livmoderen uden nærmere spec. lokalisation 01-01-1994
DC559 Kræft i livmoderen uden nærmere spec. lokalisation 01-01-1994
DC56 Kræft i æggestok 01-01-1994
DC560 Neopl mal ovarii, st. I 01-01-1994 31-12-2005
DC561 Neopl mal ovarii, st. II 01-01-1994 31-12-2005
DC562 Neopl mal ovarii, st. III 01-01-1994 31-12-2005
DC563 Neopl mal ovarii, st. IV 01-01-1994 31-12-2005
DC569 Æggestokkræft 01-01-1994
DC569A Ekstragonadal germinalcelletumor (ovarie) 01-01-2012
DC569M Æggestokkræft med metastaser 01-01-2017 31-12-2021
DC569X Lokalrecidiv fra æggestokkræft 01-04-2012 31-12-2021
DC57 Kræft i andre og ikke specificerede kvindelige kønsorganer 01-01-1994
DC570 Kræft i æggeleder 01-01-1994
DC570M Kræft i æggeleder med metastaser 01-01-2017 31-12-2021
DC571 Kræft i ligamentum latum uteri 01-01-1994
DC571M Kræft i ligamentum latum uteri med metastaser 01-01-2017 31-12-2021
DC572 Kræft i ligamentum teres uteri 01-01-1994
DC572M Kræft i ligamentum teres uteri med metastaser 01-01-2017 31-12-2021
DC573 Kræft i parametriet 01-01-1994
DC573M Kræft i parametriet med metastaser 01-01-2017 31-12-2021
DC574 Kræft i adnexa uteri 01-01-1994
DC574M Kræft i adnexa uteri med metastaser 01-01-2017 31-12-2021
DC577 Kræft i anden spec. struktur i kvindeligt kønsorgan 01-01-1994
DC577M Kræft i anden struktur i kvindeligt kønsorgan med metastaser 01-01-2017 31-12-2021
DC578 Kræft i kvind. kønsorganer overgrib.fl.lokal. 01-01-1994
DC578M Kræft i kvind. kønsorganer overgrib.fl.lokal. med metastaser 01-01-2017 31-12-2021
DC579 Kræft i kvindeligt kønsorgan UNS 01-01-1994
DC579M Kræft i kvindeligt kønsorgan med metastaser 01-01-2017 31-12-2021
DC579X Lokalrecidiv fra kræft i kvindeligt kønsorgan 01-04-2012 31-12-2021
DC58 Kræft i moderkagen 01-01-1994
DC589 Kræft i moderkagen UNS 01-01-1994
DC589A Choriokarcinom i placenta 01-01-2012
DC589B Chorionepiteliom i placenta 01-01-2012
DC589M Kræft i moderkagen med metastaser 01-01-2017 31-12-2021
DC60 Kræft i penis 01-01-1994
DC600 Kræft i forhuden 01-01-1994
DC600M Kræft i forhuden med metastaser 01-01-2016 31-12-2021
DC601 Kræft i glans penis 01-01-1994
DC601M Kræft i glans penis med metastaser 01-01-2016 31-12-2021
DC602 Kræft i corpus penis 01-01-1994
DC602M Kræft i corpus penis med metastaser 01-01-2016 31-12-2021
DC608 Kræft i penis overgribende flere lokalisationer 01-01-1994
DC608M Kræft i penis overgribende fl. lokalisationer med metastaser 01-01-2016 31-12-2021
DC609 Kræft i penis UNS 01-01-1994
DC609D Neoplasma malignum penis non spec, basocellulært, nodulært 01-04-2006 31-12-2011
DC609E Neopl. malign. penis non spec, basocellulært, superficielt 01-04-2006 31-12-2011
DC609F Neopl. malign. penis non spec, basocellulært, morphaeatype 01-04-2006 31-12-2011
DC609G Neoplasma malignum penis non spec, basocellulært, multiplex 01-04-2006 31-12-2011
DC609H Neoplasma malignum penis non spec, basocellulært, recidivans 01-04-2006 31-12-2011
DC609J Ne mal penis non spec, plan, verr (cun, B-L) 01-04-2006 31-12-2011
DC609K Neopl. malign. penis non spec, planocellulært, spinocel. 01-04-2006 31-12-2011
DC609L Ne mal penis non spec, planocellulært, Marjorlin/Melaney 01-04-2006 31-12-2011
DC609M Kræft i penis UNS med metastaser 01-04-2006 31-12-2021
DC609N Neopl. malign. penis non spec, mikrocystisk adneks karcinom 01-04-2006 31-12-2011
DC609P Neoplasma malignum penis non spec, Merkelcelle karcinom 01-04-2006 31-12-2011
DC609Q Neoplasma malignum penis non spec, adenoidt cystisk karcinom 01-04-2006 31-12-2011
DC609R Neoplasma malignum penis non spec, mb. Paget (ekstramammært) 01-04-2006 31-12-2011
DC609S Neoplasma malignum penis non spec, porokarcinom 01-04-2006 31-12-2011
DC609T Neoplasma malignum penis non spec, sebaceøst karcinom 01-04-2006 31-12-2011
DC609U Neoplasma malignum penis non spec, trichillemmalt karcinom 01-04-2006 31-12-2011
DC609V Neopl. malign. penis non spec, dermatofibrosarc. prot. 01-04-2006 31-12-2011
DC609W Neoplasma malignum penis non spec, angiosarkom 01-04-2006 31-12-2011
DC609X Lokalrecidiv fra kræft i penis 01-04-2012 31-12-2021
DC609Z Neoplasma malignum penis non spec, andet 01-04-2006 31-12-2011
DC61 Kræft i blærehalskirtlen 01-01-1994
DC619 Prostatakræft 01-01-1994
DC619M Prostatakræft med metastaser 01-01-2016 31-12-2021
DC619X Lokalrecidiv fra prostatakræft 01-04-2012 31-12-2021
DC619Y PSA-recidiv efter tidligere intenderet kurativ behandling 01-01-2014
DC619Z Kastrationsresistent prostatakræft (CRPC) 01-01-2015
DC62 Testikelkræft 01-01-1994
DC620 Kræft i ikke-nedstegen testikel 01-01-1994
DC620M Kræft i ikke-nedstegen testikel med metastaser 01-01-2016 31-12-2021
DC621 Kræft i testikel i scrotum 01-01-1994
DC621M Kræft i testikel i scrotum med metastaser 01-01-2016 31-12-2021
DC629 Testikelkræft UNS 01-01-1994
DC629A Ekstragonadal germinalcelletumor (testis) 01-01-2002
DC629M Testikelkræft med metastaser 01-01-2016 31-12-2021
DC629X Lokalrecidiv fra testikelkræft 01-04-2012 31-12-2021
DC63 Kræft i andre og ikke specificerede mandlige kønsorganer 01-01-1994
DC630 Kræft i bitestikel 01-01-1994
DC630M Kræft i bitestikel med metastaser 01-01-2016 31-12-2021
DC631 Kræft i sædstreng 01-01-1994
DC631M Kræft i sædstreng med metastaser 01-01-2016 31-12-2021
DC632 Kræft i scrotum 01-01-1994
DC632M Kræft i scrotum med metastaser 01-01-2016 31-12-2021
DC637 Kræft i andet mandligt kønsorgan 01-01-1994
DC637A Kræft i tunica vaginalis scroti 01-01-1994 30-09-2015
DC637B Kræft i vesicula seminalis 01-01-1994 30-09-2015
DC637M Kræft i andet mandligt kønsorgan med metastaser 01-01-2016 31-12-2021
DC638 Kræft i mand. kønsorganer overgrib.fl.lokal. 01-01-1994
DC638M Kræft i mand. kønsorganer overgribende fl. lok. m metastaser 01-01-2016 31-12-2021
DC639 Kræft i mandligt kønsorgan UNS 01-01-1994
DC639M Kræft i mandligt kønsorgan UNS med metastaser 01-01-2016 31-12-2021
DC639X Lokalrecidiv fra kræft i mandligt kønsorgan 01-04-2012 31-12-2021
DC64 Nyrekræft 01-01-1994
DC649 Nyrekræft 01-01-1994
DC649M Nyrekræft med metastaser 01-01-2016 31-12-2021
DC649X Lokalrecidiv fra nyrekræft 01-04-2012 31-12-2021
DC65 Kræft i nyrebækken 01-01-1994
DC659 Kræft i nyrebækken 01-01-1994
DC659M Kræft i nyrebækken med metastaser 01-01-2016 31-12-2021
DC659X Lokalrecidiv fra kræft i nyrebækken 01-04-2012 31-12-2021
DC66 Kræft i urinleder 01-01-1994
DC669 Kræft i urinleder 01-01-1994
DC669M Kræft i urinleder med metastaser 01-01-2016 31-12-2021
DC669X Lokalrecidiv fra kræft i urinleder 01-04-2012 31-12-2021
DC67 Kræft i urinblæren 01-01-1994
DC670 Neopl mal trigoni vesicae urinariae 01-01-1994 31-12-2011
DC671 Neopl mal vesicae urinariae loft 01-01-1994 31-12-2011
DC672 Neopl mal vesicae urinariae sidevæg 01-01-1994 31-12-2011
DC673 Neopl mal vesicae urinariae forvæg 01-01-1994 31-12-2011
DC674 Neopl mal vesicae urinariae bagvæg 01-01-1994 31-12-2011
DC675 Neopl mal cervicis vesicae urinariae 01-01-1994 31-12-2011
DC675A Neopl mal vesicae urinariae, orificium internum urethrae 01-01-1994 31-12-2011
DC676 Kræft i ostium ureteris 01-01-1994 30-09-2015
DC677 Kræft i urachus 01-01-1994
DC677M Kræft i urachus med metastaser 01-01-2016 31-12-2021
DC678 Neopl mal vesicae urinariae overgribende flere regioner 01-01-1994 31-12-2011
DC679 Kræft i urinblæren UNS 01-01-1994
DC679M Kræft i urinblæren med metastaser 01-01-2016 31-12-2021
DC679X Lokalrecidiv fra kræft i urinblæren 01-04-2012 31-12-2021
DC68 Kræft i andre og ikke specificerede urinorganer 01-01-1994
DC680 Kræft i urinrøret 01-01-1994
DC680M Kræft i urinrøret med metastaser 01-01-2016 31-12-2021
DC680X Lokalrecidiv fra kræft i urinrøret 01-01-2013 31-12-2021
DC681 Kræft i glandula paraurethralis s. bulbourethralis 01-01-1994
DC681M Kræft i gl. paraurethralis s. bulbourethralis med metastaser 01-01-2016 31-12-2021
DC688 Kræft i urinorganer overgribende flere lokalisationer 01-01-1994
DC688M Kræft i urinorganer overgribende flere lok. med metastaser 01-01-2016 31-12-2021
DC689 Kræft i urinorgan UNS 01-01-1994
DC689M Kræft i urinorgan UNS med metastaser 01-01-2016 31-12-2021
DC689X Lokalrecidiv fra kræft i urinorgan 01-04-2012 31-12-2021
DC69 Kræft i øje og omgivende strukturer 01-01-1994
DC690 Kræft i konjunktiva 01-01-1994
DC690M Kræft i konjunktiva med metastaser 01-01-2017 31-12-2021
DC691 Kræft i cornea 01-01-1994
DC691M Kræft i cornea med metastaser 01-01-2017 31-12-2021
DC692 Kræft i retina 01-01-1994
DC692A Retinoblastom 01-01-1996
DC692M Kræft i retina med metastaser 01-01-2017 31-12-2021
DC693 Kræft i choroidea 01-01-1994
DC693M Kræft i choroidea med metastaser 01-01-2017 31-12-2021
DC694 Kræft i corpus ciliare 01-01-1994
DC694A Kræft i øjeæble 01-01-1994 31-12-2012
DC694M Kræft i corpus ciliare med metastaser 01-01-2017 31-12-2021
DC695 Kræft i tårekirtel eller tårekanal 01-01-1994
DC695A Kræft i tårekanal 01-01-1994
DC695B Kræft i tårekirtel 01-01-1994
DC695M Kræft i tårekirtel eller tårekanal med metastaser 01-01-2017 31-12-2021
DC696 Kræft i øjenhule 01-01-1994
DC696M Kræft i øjenhule med metastaser 01-01-2017 31-12-2021
DC697 Malignt melanom i øjet 01-01-1996 31-12-2011
DC698 Kræft i øje overgribende flere lokalisationer 01-01-1994
DC698M Kræft i øje overgribende flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC699 Kræft i øje UNS 01-01-1994
DC699A Kræft i øjeæble 01-01-2013
DC699M Kræft i øje eller omgivende strukturer med metastaser 01-01-2017 31-12-2021
DC699X Lokalrecidiv fra kræft i øje 01-04-2012 31-12-2021
DC70 Kræft i hjernehinde og rygmarvshinde 01-01-1994
DC700 Kræft i hjernehinde 01-01-1994
DC700M Kræft i hjernehinde med metastaser 01-01-2017 31-12-2021
DC701 Kræft i rygmarvshinde 01-01-1994
DC701M Kræft i rygmarvshinde med metastaser 01-01-2017 31-12-2021
DC709 Kræft i hjernehinde eller rygmarvshinde UNS 01-01-1994
DC709M Kræft i hjernehinde eller rygmarvshinde med metastaser 01-01-2017 31-12-2021
DC709X Lokalrecidiv fra kræft i hjernehinde eller rygmarvshinde 01-04-2012 31-12-2021
DC71 Kræft i hjernen 01-01-1994
DC710 Kræft i storhjernen 01-01-1994
DC710A Kræft i corpus callosum 01-01-1994
DC710B Supratentoriel kræft i storhjernen UNS 01-01-1994
DC710M Kræft i storhjernen med metastaser 01-01-2017 31-12-2021
DC711 Kræft i hjernens pandelap 01-01-1994
DC711M Kræft i hjernens pandelap med metastaser 01-01-2017 31-12-2021
DC712 Kræft i hjernens tindingelap 01-01-1994
DC712M Kræft i hjernens tindingelap med metastaser 01-01-2017 31-12-2021
DC713 Kræft i hjernens isselap 01-01-1994
DC713M Kræft i hjernens isselap med metastaser 01-01-2017 31-12-2021
DC714 Kræft i hjernens nakkelap 01-01-1994
DC714M Kræft i hjernens nakkelap med metastaser 01-01-2017 31-12-2021
DC715 Intraventrikulær kræft i hjernen 01-01-1994
DC715M Intraventrikulær kræft i hjernen med metastaser 01-01-2017 31-12-2021
DC716 Kræft i lillehjernen 01-01-1994
DC716M Kræft i lillehjernen med metastaser 01-01-2017 31-12-2021
DC717 Kræft i hjernestammen eller 4. ventrikel 01-01-1994
DC717A Kræft i 4. ventrikel 01-01-1994
DC717B Kræft i hjernestammen 01-01-1994
DC717C Infratentoriel kræft i hjernen UNS 01-01-1994
DC717M Kræft i hjernestammen eller 4. ventrikel med metastaser 01-01-2017 31-12-2021
DC718 Kræft i hjernen overgribende flere lokalisationer 01-01-1994
DC718M Kræft i hjernen overgrib. flere lokalisationer m. metastaser 01-01-2017 31-12-2021
DC719 Kræft i hjernen UNS 01-01-1994
DC719M Kræft i hjernen med metastaser 01-01-2017 31-12-2021
DC719X Lokalrecidiv fra kræft i hjernen 01-04-2012 31-12-2021
DC72 Kræft i rygmarv, kranienerver og andre dele af CNS 01-01-1994
DC720 Kræft i rygmarven 01-01-1994
DC720M Kræft i rygmarven med metastaser 01-01-2017 31-12-2021
DC721 Kræft i cauda equina 01-01-1994
DC721M Kræft i cauda equina med metastaser 01-01-2017 31-12-2021
DC722 Kræft i lugtenerve 01-01-1994
DC722A Kræft i bulbus olfactorius 01-01-1994
DC722M Kræft i lugtenerve med metastaser 01-01-2017 31-12-2021
DC723 Kræft i synsnerve 01-01-1994
DC723M Kræft i synsnerve med metastaser 01-01-2017 31-12-2021
DC724 Kræft i hørenerve 01-01-1994
DC724M Kræft i hørenerve med metastaser 01-01-2017 31-12-2021
DC725 Kræft i anden hjernenerve eller hjernenerve UNS 01-01-1994
DC725M Kræft i anden hjernenerve/hjernenerve med metastaser 01-01-2017 31-12-2021
DC728 Kræft i CNS overgrib.fl.lokal. 01-01-1994
DC728A Carcinomatosis pleurae 01-01-2010 01-01-2010
DC728M Kræft i CNS overgribende flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC729 Kræft i centralnervesystemet UNS 01-01-1994
DC729M Kræft i centralnervesystemet med metastaser 01-01-2017 31-12-2021
DC729X Lokalrecidiv fra kræft i centralnervesystemet 01-04-2012 31-12-2021
DC73 Kræft i skjoldbruskkirtlen 01-01-1994
DC739 Kræft i skjoldbruskkirtlen 01-01-1994
DC739M Kræft i skjoldbruskkirtlen med metastaser 01-01-2017 31-12-2021
DC739X Lokalrecidiv fra kræft i skjoldbruskkirtlen 01-04-2012 31-12-2021
DC74 Kræft i binyre 01-01-1994
DC740 Kræft i binyrebark 01-01-1994
DC740M Kræft i binyrebark med metastaser 01-01-2017 31-12-2021
DC741 Kræft i binyremarv 01-01-1994
DC741M Kræft i binyremarv med metastaser 01-01-2017 31-12-2021
DC749 Kræft i binyre UNS 01-01-1994
DC749M Kræft i binyre med metastaser 01-01-2017 31-12-2021
DC749X Lokalrecidiv fra kræft i binyre 01-04-2012 31-12-2021
DC75 Kræft i andre endokrine kirtler og lignende strukturer 01-01-1994
DC750 Kræft i biskjoldbruskkirtel 01-01-1994
DC750M Kræft i biskjoldbruskkirtel med metastaser 01-01-2017 31-12-2021
DC751 Kræft i hypofysen 01-01-1994
DC751M Kræft i hypofysen med metastaser 01-01-2017 31-12-2021
DC752 Kræft i ductus craniopharyngeus 01-01-1994
DC752M Kræft i ductus craniopharyngeus med metastaser 01-01-2017 31-12-2021
DC753 Kræft i corpus pineale 01-01-1994
DC753M Kræft i corpus pineale med metastaser 01-01-2017 31-12-2021
DC754 Kræft i glomus caroticum 01-01-1994
DC754M Kræft i glomus caroticum med metastaser 01-01-2017 31-12-2021
DC755 Kræft i corpus para-aorticus eller andet paraganglion 01-01-1994
DC755A Kræft i corpus para-aorticus 01-01-1994
DC755B Kræft i andet paraganglion 01-01-1994
DC755M Kræft i corpus para-aorticus/andet paraganglion m.metastaser 01-01-2017 31-12-2021
DC758 Pluriglandulær kræft UNS 01-01-1994
DC758M Pluriglandulær kræft med metastaser 01-01-2017 31-12-2021
DC759 Kræft i endokrin kirtel UNS 01-01-1994
DC759M Kræft i endokrin kirtel med metastaser 01-01-2017 31-12-2021
DC759X Lokalrecidiv fra kræft i endokrin kirtel 01-04-2012 31-12-2021
DC76 Kræft med andre og dårligt specificerede lokalisationer 01-01-1994
DC760 Kræft i hoved/ansigt/hals uden nærmere spec. lokalisation 01-01-1994
DC760A Kræft i hovedet uden spec. lokalisation 01-01-1994
DC760B Kræft i halsen uden spec. lokalisation 01-01-1994
DC760C Kræft i ansigtet uden spec. lokalisation 01-01-1994
DC760M Kræft i hoved/ansigt/hals med metastaser 01-01-2017 31-12-2021
DC761 Kræft i thorax uden spec. lokalisation 01-01-1994
DC761M Kræft i thorax uden spec. lokalisation med metastaser 01-01-2017 31-12-2021
DC762 Kræft i abdomen uden spec. lokalisation 01-01-1994
DC762M Kræft i abdomen uden spec. lokalisation med metastaser 01-01-2017 31-12-2021
DC763 Kræft i bækkenet uden spec. lokalisation 01-01-1994
DC763M Kræft i bækkenet uden spec. lokalisation med metastaser 01-01-2017 31-12-2021
DC764 Kræft i arm u spec. lokal. 01-01-1994
DC764M Kræft i arm med metastaser 01-01-2017 31-12-2021
DC765 Kræft i ben u spec. lokal. 01-01-1994
DC765M Kræft i ben med metastaser 01-01-2017 31-12-2021
DC767 Kræft med anden dårligt specificeret lokalisation 01-01-1994
DC767M Kræft med dårligt specificeret lokalisation med metastaser 01-01-2017 31-12-2021
DC768 Kræft med anden/dårligt spec. lokal. overgribende fl. lokal. 01-01-1994
DC768M Kræft UNS overgribende flere lokalisationer med metastaser 01-01-2017 31-12-2021
DC77 Metastaser og kræft UNS i lymfeknuder 01-01-1994
DC770 Metastase eller kræft UNS i lymfeknude i hoved/ansigt/hals 01-01-1994
DC770A Metastase i lymfeknude i hovedet 01-01-1994
DC770A1 Regional lymfeknudemetastase i hovedet 01-07-2018
DC770A2 Fjernmetastase i lymfeknude i hovedet 01-07-2018
DC770B Kræft UNS i lymfeknude i hovedet 01-01-1994
DC770C Metastase i lymfeknude i halsen 01-01-1994
DC770C1 Regional lymfeknudemetastase i halsen 01-07-2018
DC770C2 Fjernmetastase i lymfeknude i halsen 01-07-2018
DC770D Kræft UNS i lymfeknude i halsen 01-01-1994
DC770E Metastase i lymfeknude i ansigtet 01-01-1994
DC770E1 Regional lymfeknudemetastase i ansigtet 01-07-2018
DC770E2 Fjernmetastase i lymfeknude i ansigtet 01-07-2018
DC770F Kræft UNS i lymfeknude i ansigtet 01-01-1994
DC770G Metastase i supraclaviculær lymfeknude 01-01-1994
DC770G1 Regional supraclaviculær lymfeknudemetastase 01-07-2018
DC770G2 Fjernmetastase i supraclaviculær lymfeknude 01-07-2018
DC770H Kræft UNS i supraclaviculær lymfeknude 01-01-1994
DC771 Metastase eller kræft UNS i intratorakal lymfeknude 01-01-1994
DC771A Metastase i intratorakal lymfeknude 01-01-1994
DC771A1 Regional intratorakal lymfeknudemetastase 01-07-2018
DC771A2 Fjernmetastase i intratorakal lymfeknude 01-07-2018
DC771B Kræft UNS i intratorakal lymfeknude 01-01-1994
DC772 Metastase eller kræft UNS i intraabdominal lymfeknude 01-01-1994
DC772A Metastase i intraabdominal lymfeknude 01-01-1994
DC772A1 Regional intraabdominal lymfeknudemetastase 01-07-2018
DC772A2 Fjernmetastase i intraabdominal lymfeknude 01-07-2018
DC772B Kræft UNS i intraabdominal lymfeknude 01-01-1994
DC773 Metastase eller kræft UNS i lymfeknude i aksil eller arm 01-01-1994
DC773A Metastase i lymfeknude i aksil 01-01-1994
DC773A1 Regional lymfeknudemetastase i aksil 01-07-2018
DC773A2 Fjernmetastase i lymfeknude i aksil 01-07-2018
DC773B Kræft UNS i lymfeknude i aksil 01-01-1994
DC773C Metastase i lymfeknude i overekstremitet 01-01-1994
DC773C1 Regional lymfeknudemetastase i overekstremitet 01-07-2018
DC773C2 Fjernmetastase i lymfeknude i overekstremitet 01-07-2018
DC773D Kræft UNS i lymfeknude i overekstremitet 01-01-1994
DC773E Metastase i pektoral lymfeknude 01-01-2012
DC773E1 Regional pektoral lymfeknudemetastase 01-07-2018
DC773E2 Fjernmetastase i pektoral lymfeknude 01-07-2018
DC773F Kræft UNS i pektoral lymfeknude 01-01-2012
DC774 Metastase eller kræft UNS i lymfeknude i lyske el. ben 01-01-1994
DC774A Metastase i lymfeknude i underekstremitet 01-01-1994
DC774A1 Regional lymfeknudemetastase i underekstremitet 01-07-2018
DC774A2 Fjernmetastase i lymfeknude i underekstremitet 01-07-2018
DC774B Kræft UNS i lymfeknude i underekstremitet 01-01-1994
DC774C Metastase i lymfeknude i lyske 01-01-1994
DC774C1 Regional lymfeknudemetastase i lyske 01-07-2018
DC774C2 Fjernmetastase i lymfeknude i lyske 01-07-2018
DC774D Kræft UNS i lymfeknude i lyske 01-01-1994
DC775 Metastase eller kræft UNS i intrapelvin lymfeknude 01-01-1994
DC775A Metastase i intrapelvin lymfeknude 01-01-1994
DC775A1 Regional intrapelvin lymfeknudemetastase 01-07-2018
DC775A2 Fjernmetastase i intrapelvin lymfeknude 01-07-2018
DC775B Kræft UNS i intrapelvin lymfeknude 01-01-1994
DC778 Metastase el. kræft UNS i lymfeknuder i mult. lokalisationer 01-01-1994
DC778A Metastase i lymfeknuder i multiple lokalisationer 01-01-1994
DC778A1 Multiple regionale lymfeknudemetastaser 01-07-2018
DC778A2 Fjernmetastaser i lymfeknuder i multiple lokalisationer 01-07-2018
DC778B Kræft UNS i lymfeknuder i multiple lokalisationer 01-01-1994
DC779 Metastase eller kræft UNS i lymfeknude UNS 01-01-1994
DC779A Metastase i lymfeknude UNS 01-01-1994
DC779A1 Regional lymfeknudemetastase UNS 01-07-2018
DC779A2 Fjernmetastase i lymfeknude UNS 01-07-2018
DC779B Kræft UNS i lymfeknude UNS 01-01-1994
DC78 Metastaser i åndedrætsorganer og fordøjelsessystemet 01-01-1994
DC780 Fjernmetastase i lunge 01-01-1994
DC781 Fjernmetastase i mediastinum 01-01-1994
DC782 Fjernmetastase i lungehinde 01-01-1994
DC782A Carcinomatosis pleurae 01-01-2010
DC782B Malign pleural effusion 01-01-2012
DC783 Fjernmetastase med anden/ikke spec. lokal. i åndedrætsorgan 01-01-1994
DC784 Fjernmetastase i tyndtarmen 01-01-1994
DC784A Fjernmetastase i duodenum 01-01-2010
DC785 Fjernmetastase i tyktarmen eller endetarmen 01-01-1994
DC785A Fjernmetastase i tyktarmen 01-01-1994
DC785B Fjernmetastase i endetarmen 01-01-1994
DC786 Metastase i retroperitonale rum eller i peritoneum 01-01-1994
DC786A Malign ascites UNS 01-01-1994
DC786B Metastase i peritoneum 01-01-1994
DC786C Metastase i retroperitoneale rum 01-01-1994
DC786D Carcinomatosis peritonei 01-01-2010
DC786E Pseudomyxoma peritonei 01-01-2012
DC787 Fjernmetastase i leveren 01-01-1994
DC788 Fjernmetastase m. anden/ikke spec. lokal. i fordøjelsesorgan 01-01-1994
DC79 Metastaser i andre specificerede lokalisationer 01-01-1994
DC790 Fjernmetastase i nyre eller nyrebækken 01-01-1994
DC790A Fjernmetastase i nyrebækken 01-01-1994
DC790B Fjernmetastase i nyre 01-01-1994
DC791 Fjernmetastase i andet urinorgan eller mandligt kønsorgan 01-01-1994
DC791I Fjernmetastase i urinblæren 01-01-2002
DC791J Fjernmetastase i prostata 01-01-2002
DC791S Fjernmetastase i penis 01-01-2002
DC791T Fjernmetastase i testikel 01-01-2002
DC791U Fjernmetastase i urinleder 01-01-2002
DC791V Fjernmetastase i urinrøret 01-01-2002
DC791X Fjernmetastase i urinorganer overgribende flere lokalisat. 01-01-2002 30-09-2019
DC792 Fjernmetastase i huden 01-01-1994
DC793 Fjernmetastase i hjernen eller hjernehinder 01-01-1994
DC793A Fjernmetastase i hjernen 01-01-1994
DC793B Fjernmetastase i hjernehinde 01-01-1994
DC793C Fjernmetastase i rygmarvshinde 01-01-1994
DC794 Fjernmetastase med anden/ikke spec. lokal. i nervesystemet 01-01-1994
DC795 Fjernmetastase i knogle eller knoglemarven 01-01-1994
DC795A Fjernmetastase i knoglemarven 01-01-1994
DC795B Fjernmetastase i knogle 01-01-1994
DC795C Fjernmetastase i ryghvirvel 01-01-2010
DC795D Fjernmetastase i ribben 01-01-2012
DC795E Fjernmetastase i kraniet 01-01-2012
DC796 Fjernmetastase i æggestok 01-01-1994
DC797 Fjernmetastase i binyre 01-01-1994
DC798 Metastase UNS 01-01-1994
DC798A Carcinomatosis UNS 01-01-2010
DC798B Regional lymfeknudemetastase til stede UNS 01-07-2018 31-03-2019
DC798C Fjernmetastaser og regionale lymfeknudemetastaser UNS 01-07-2018
DC798D Fjernmetastase UNS 01-04-2019
DC798E In-transit metastase i hud 01-04-2019
DC798F Fjernmetastaser i multiple lokalisationer 01-01-2019
DC798Z Fjernmetastaser i anden specificeret lokalisation IKA 01-01-2019
DC799 Sekundær kræftsygdom UNS 01-01-2015
DC80 Ikke nærmere spec. kræft (ukendt primærtumor) 01-01-1994
DC800 Primær kræftsygdom uden kendt lokalisation 01-01-2015
DC800M Primær kræftsygdom uden kendt lokalisation med metastaser 01-01-2017 31-12-2021
DC809 Kræftsygdom UNS 01-01-1994
DC809A Malign kakeksi 01-01-2012
DC809M Kræftsygdom UNS med metastaser 01-01-2017 31-12-2021
DC81 Hodgkin lymfomer 01-01-1994
DC810 Nodulært lymfocytdomineret Hodgkin lymfom 01-01-1994
DC811 Klassisk Hodgkin lymfom med nodulær sklerose 01-01-1994
DC812 Klassisk Hodgkin lymfom med blandet cellularitet 01-01-1994
DC813 Klassisk lymfocytfattigt Hodgkin lymfom 01-01-1994
DC814 Klassisk lymfocytrigt Hodgkin lymfom 01-01-2012
DC817 Andet klassisk Hodgkin lymfom 01-01-1994
DC819 Hodgkin lymfom UNS 01-01-1994
DC82 Follikulære lymfomer 01-01-1994
DC820 Follikulært lymfom, grad I 01-01-1994
DC821 Follikulært lymfom, grad II 01-01-1994
DC822 Follikulært lymfom, grad III 01-01-1994
DC825 Diffust follikelcenter lymfom 01-01-2012
DC826 Kutant follikelcenter lymfom 01-01-2012
DC827 Andet follikulært lymfom 01-01-1994
DC829 Follikulært lymfom UNS 01-01-1994
DC83 Ikke-follikulære lymfomer 01-01-1994
DC830 Småcellet B-celle lymfom 01-01-1994
DC830B Lymfoplasmacytært lymfom 01-01-2012
DC830C Nodalt marginalzonelymfom 01-01-2012
DC830D Splenisk marginalzonelymfom 01-01-2012
DC831 Mantle celle lymfom (MCL) 01-01-1994
DC831A Centrocytisk lymfom 01-01-2012
DC831B Malign lymfomatøs polypose 01-01-2012
DC832 Lymph mal non-Hodg af diff type mixed small and large cell 01-01-1994 31-12-2011
DC833 Diffust storcellet B-celle lymfom 01-01-1994
DC833A Anaplastisk diffust storcellet B-celle lymfom 01-01-2012
DC833B CD30-positivt diffust storcellet B-celle lymfom 01-01-2012
DC833C Centroblastært diffust storcellet B-celle lymfom 01-01-2012
DC833D Immunoblastært diffust storcellet B-celle lymfom 01-01-2012
DC833E Plasmablastært diffust storcellet B-celle lymfom 01-01-2012
DC833F T-cellerigt diffust storcellet B-celle lymfom 01-01-2012
DC834 Lymphoma mal non-Hodgkin af diffus immunoblastær type 01-01-1994 31-12-2011
DC835 Lymfoblastært lymfom 01-01-1994
DC835A Lymfoblastært B-celle lymfom 01-01-2012
DC835B Lymfoblastært T-celle lymfom 01-01-2012
DC835C Lymfoblastært lymfom UNS 01-01-2012
DC836 Lymphoma mal non-Hodgkin af diffus udifferentieret type 01-01-1994 31-12-2011
DC837 Burkitt lymfom 01-01-1994
DC837A Atypisk Burkitt lymfom 01-01-2012
DC837B Burkitt-lignende lymfom 01-01-2012
DC838 Andet ikke-follikulært lymfom 01-01-1994
DC838A Primært effusionslymfom (af B-celle type) 01-01-2012
DC838B Intravaskulært storcellet B-celle lymfom 01-01-2012
DC839 Ikke-follikulært (diffust) lymfom UNS 01-01-1994
DC84 Modne NK/T-celle lymfomer 01-01-1994
DC840 Mycosis fungoides 01-01-1994
DC840A Mycosis fungoides associeret med follikulær mucinose 01-04-2000
DC840B Pagetoid retikulose 01-04-2000
DC840C Granulomatøs slack skin (lymphoma malignum) 01-04-2000
DC841 Sézarys sygdom 01-01-1994
DC842 Lymphoma mal T-zone 01-01-1994 31-12-2011
DC843 Lymphoma mal lymfoepiteloidt 01-01-1994 31-12-2011
DC844 Perifert T-celle lymfom UNS 01-01-1994
DC844A Storcellet Pleomorft CD30+ T-celle lymfom 01-04-2000 31-12-2011
DC844B Storcellet Pleomorft CD30- T-celle lymfom 01-04-2000 31-12-2011
DC844C Storcellet immunoblastisk CD30+ T-celle lymfom 01-04-2000 31-12-2011
DC844D Storcellet immunoblastisk CD30- T-celle lymfom 01-04-2000 31-12-2011
DC844E Middel-småcellet pleomorft T-celle lymfom 01-04-2000 31-12-2011
DC844F Lymfoepitelioidt lymfom 01-01-2012
DC844H Modent T-celle lymfom UNS 01-01-2012
DC845 Andet modent NK/T-celle lymfom 01-01-1994
DC845A Storcellet anaplastisk CD30+ T-celle lymfom 01-04-2000 31-12-2011
DC845B Storcellet anaplastisk CD30+ T-celle lymfom, primært i huden 01-04-2000 31-12-2011
DC845C Subkutant pannikulitrelateret T-lymfom 01-04-2000 31-12-2011
DC845D Angiocentrisk T-/NK-celle lymfom 01-04-2000 31-12-2011
DC846 Anaplastisk storcellet lymfom, ALK-positivt 01-01-2012
DC846A Anaplastisk storcellet lymfom, CD30-positivt 01-01-2012
DC847 Anaplastisk storcellet lymfom, ALK-negativt 01-01-2012
DC848 Kutant T-celle lymfom UNS 01-01-2012
DC849 Modent NK/T-celle lymfom UNS 01-01-2012
DC85 Andre og ikke specificerede non-Hodgkin lymfomer 01-01-1994
DC850 Lymphosarcoma 01-01-1994 31-12-2011
DC851 B-celle lymfom UNS 01-01-1994
DC851A Follikelcenter B-celle lymfom 01-04-2000 31-12-2011
DC851B Marginal zone B-celle lymfom (immunocytom) 01-04-2000 31-12-2011
DC851C Diffust storcellet B-celle lymfom 01-04-2000 31-12-2011
DC851D T-cellerigt B-celle lymfom 01-04-2000 31-12-2011
DC851E Storcellet intravaskulært B-celle lymfom 01-04-2000 31-12-2011
DC852 Mediastinalt (tymisk) storcellet B-celle lymfom 01-01-2012
DC857 Andet non-Hodgkin lymfom 01-01-1994
DC857A Reticulosis lymphatica follicularis 01-01-1994 31-12-2011
DC857B Polymorf posttransplantations lymfoproliferativ sygd. (PTLD) 01-01-2012
DC859 Lymfom (neoplasi) UNS 01-01-1994
DC859A Malignt lymfom uden specifikation 01-10-2004 31-12-2011
DC859B Lymfom uden specifikation 01-10-2004 31-12-2011
DC86 Andre NK/T-celle lymfomer 01-01-2012
DC860 Ekstranodalt NK/T-celle lymfom, nasal type 01-01-2012
DC861 Hepatosplenisk T-celle lymfom 01-01-2012
DC862 Enteropati-type (intestinalt) T-celle lymfom 01-01-2012
DC863 Subkutant panniculitis-lignende T-celle lymfom 01-01-2012
DC864 Blastisk NK-celle lymfom 01-01-2012
DC865 Angioimmunoblastært T-celle lymfom 01-01-2012
DC866 Primært kutane CD30-positive T-celle proliferationer 01-01-2012
DC866A Lymfomatoid papulose 01-01-2012 31-03-2019
DC866B Primært kutant anaplastisk storcellet lymfom 01-01-2012
DC866C Primært kutant CD30-positivt storcellet lymfom 01-01-2012
DC88 Maligne immunoproliferative sygdomme 01-01-1994
DC880 Waldenströms makroglobulinæmi 01-01-1994
DC881 Paraproteinaemia alpha heavy chain 01-01-1994 31-12-2011
DC882 Anden heavy chain disease 01-01-1994
DC882A Gamma heavy chain disease 01-01-2012
DC882B My heavy chain disease 01-01-2012
DC883 Immunoproliferativ tyndtarmssygdom 01-01-1994
DC883A Alpha heavy chain disease 01-01-2012
DC883B Middelhavs lymfom 01-01-2012
DC884 Ekstranodalt marginalzone B-celle lymfom 01-01-2012
DC884A Lymfom af mucosa-associeret lymfoidt væv (MALT-lymfom) 01-01-2012
DC884B Lymfom af hud-associeret lymfoidt væv (SALT-lymfom) 01-01-2012
DC884C Lymfom af bronkie-associeret lymfoidt væv (BALT-lymfom) 01-01-2012
DC887 Anden malign immunoproliferativ sygdom 01-01-1994
DC889 Malign immunoproliferativ sygdom UNS 01-01-1994
DC90 Maligne plasmacelle neoplasier 01-01-1994
DC900 Myelomatose 01-01-1994
DC901 Plasmacelle leukæmi 01-01-1994
DC902 Solitært ikke-ossøst plasmacytom 01-01-1994
DC902A Myeloma solitarium 01-01-1994 31-12-2011
DC903 Solitært ossøst plasmacytom 01-01-2012
DC91 Lymfatiske leukæmier 01-01-1994
DC910 Akut lymfoblastær leukæmi (ALL) 01-01-1994
DC911 Kronisk lymfatisk leukæmi af B-celle type (B-CLL) 01-01-1994
DC911A Lymfoplasmacytær leukæmi 01-01-2012
DC911B Richter syndrom 01-01-2012
DC912 Leukaemia lymphatica subacuta 01-01-1994 31-12-2011
DC913 Prolymfocyt leukæmi af B-celle type 01-01-1994
DC914 Hårcelle leukæmi 01-01-1994
DC914A Reticuloendotheliosis leucaemica 01-01-1994 31-12-2011
DC915 Adult T-celle lymfom/leukæmi (HTLV-1-associeret) 01-01-1994
DC915A Adult T-celle lymfom/leukæmi (HTLV-1-assoc.), akut variant 01-01-2012
DC915B Adult T-celle lymfom/leukæmi (HTLV-1-assoc.), kron. variant 01-01-2012
DC915C Adult T-celle lymfom/leukæmi (HTLV-1-assoc), lymfomatoid var 01-01-2012
DC915D Adult T-celle lymfom/leukæmi (HTLV-1-assoc), smouldering var 01-01-2012
DC916 Prolymfocyt leukæmi af T-celle type 01-01-2012
DC917 Anden lymfatisk leukæmi 01-01-1994
DC917A Leukaemia aleukaemica lymphatica 01-01-1994 31-12-2011
DC917B Large granular T-celle lymfocytær leukæmi 01-01-2012
DC918 Moden B-celle leukæmi af Burkitt-type 01-01-2012
DC919 Lymfatisk leukæmi UNS 01-01-1994
DC92 Myeloide leukæmier 01-01-1994
DC920 Akut myeloblastær leukæmi (AML) 01-01-1994
DC920A Akut myeloblastær leukæmi med minimal differentiering 01-01-2012
DC920B Akut myeloblastær leukæmi med modning 01-01-2012
DC920C Akut myeloblastær leukæmi, AML1/ETO 01-01-2012
DC920D Akut myeloblastær leukæmi, AML M0 01-01-2012
DC920E Akut myeloblastær leukæmi, AML M1 01-01-2012
DC920F Akut myeloblastær leukæmi, AML M2 01-01-2012
DC920G Akut myeloblastær leukæmi, AML med t(8;21) 01-01-2012
DC920H Akut myeloblastær leukæmi UNS (uden FAB-klassificering) 01-01-2012
DC920J Refraktær anæmi m overskud af blaster i transformation 01-01-2012 31-03-2012
DC921 Kronisk myeloid leukæmi (CML), BCR/ABL-positiv 01-01-1994
DC921A Kronisk myeloid leukæmi med blastkrise 01-01-2012
DC922 Atypisk kronisk myeloid leukæmi, BCR/ABL-negativ 01-01-1994
DC923 Myeloidt sarkom 01-01-1994
DC923A Chloroma 01-01-1994
DC923B Granulocytært sarkom 01-01-1994
DC924 Akut myeloblastær leukæmi, AML M3 01-01-1994
DC924A Akut myeloblastær leukæmi M3 med t(15;17) og varianter 01-01-2012
DC925 Akut myeloblastær leukæmi, AML M4 01-01-1994
DC925A Akut myeloblastær leukæmi M4 Eo med inv(16) eller t(16;16) 01-01-2012
DC926 Akut myeloblastær leukæmi med 11q23-abnormalitet 01-01-2012
DC926A Akut myeloblastær leukæmi med variation af MLL-gen 01-01-2012
DC927 Anden myeloid leukæmi 01-01-1994
DC927A Leukaemia aleukaemica myeloides 01-01-1994 31-12-2011
DC927B Kronisk neutrofil leukæmi 01-01-2012
DC928 Akut myeloid leukæmi med multilinje dysplasi 01-01-2012
DC929 Myeloid leukæmi UNS 01-01-1994
DC93 Monocytære leukæmier 01-01-1994
DC930 Akut monoblastær leukæmi, AML M5 01-01-1994
DC930A Akut monoblastær, AML M5a 01-01-2012
DC930B Akut monoblastær, AML M5b 01-01-2012
DC931 Kronisk myelomonocytær leukæmi, CMML 01-01-1994
DC931A Kronisk myelomonocytær leukæmi, CMML-1 01-01-2012
DC931B Kronisk myelomonocytær leukæmi, CMML-2 01-01-2012
DC931C Kronisk myelomonocytær, CMML med eosinofili 01-01-2012
DC932 Leukaemia monocytica subacuta 01-01-1994 31-12-2011
DC933 Juvenil myelomonocytær leukæmi 01-01-2012
DC937 Anden monocytær leukæmi 01-01-1994
DC939 Monocytær leukæmi UNS 01-01-1994
DC94 Andre leukæmier af specificerede celletyper 01-01-1994
DC940 Akut erytroid leukæmi, M6 (a)(b) 01-01-1994
DC940A Erytroleukæmi UNS 01-01-2012
DC941 Erythroleukaemia chronica 01-01-1994 31-12-2011
DC942 Akut megakaryoblastær leukæmi, M7 01-01-1994
DC943 Mastcelle leukæmi 01-01-1994
DC943A Mastcelleleukæmi 01-01-1994 31-12-2011
DC944 Akut myelofibrose 01-01-1994
DC945 Myelofibrosis acuta 01-01-1994 31-12-2011
DC946 Uklassificerbar myelodysplasi/myeloproliferativ sygdom 01-01-2012
DC947 Anden leukæmi 01-01-1994
DC947A Leukaemia eosinophilica 01-01-1994 31-12-2011
DC947B Aggressiv NK-celle leukæmi 01-01-2012
DC947C Akut basofil leukæmi 01-01-2012
DC95 Leukæmier af ikke spec. celletype 01-01-1994
DC950 Akut leukæmi af ikke spec. celletype 01-01-1994
DC950A Blastcelleleukæmi 01-01-1994 31-12-2011
DC950B Leukaemia acuta, stamcelleleukæmi 01-01-1994 31-12-2011
DC950C Akut bilineær leukæmi 01-01-2012
DC950D Akut leukæmi af blandet linearitet 01-01-2012
DC951 Kronisk leukæmi af ikke spec. celletype 01-01-1994
DC952 Leukaemia subacuta uden specifikation 01-01-1994 31-12-2011
DC957 Anden leukæmi af ikke spec. celletype 01-01-1994
DC959 Leukæmi UNS 01-01-1994
DC96 An/ikke-spec maligne neoplasier fra lymfoidt/hæmatopoidt væv 01-01-1994
DC960 Multifokal og multisyst. Langerhans-celle histiocytosis 01-01-1994
DC960A Histiocytosis X, multisystemisk 01-01-2012
DC961 Histiocytosis maligna 01-01-1994 31-12-2011
DC962 Malign mastcelle tumor 01-01-1994
DC962B Mastcelle sarkom 01-01-2012
DC963 Lymphoma mal histiocyticum verum 01-01-1994 31-12-2011
DC964 Dendritcelle sarkom (accessoriske celler) 01-01-2012
DC964A Interdigiterende dendritcelle sarkom 01-01-2012
DC964B Langerhans-celle sarkom 01-01-2012
DC964C Follikulært dendritcelle sarkom 01-01-2012
DC965 Multifokal og unisystemisk Langerhans-celle histiocytose 01-01-2012
DC965A Hand-Schüller-Christian sygdom 01-01-2012
DC965B Histiocytosis X, multifokal 01-01-2012
DC966 Unifokal Langerhans-celle histiocytose 01-01-2012
DC966A Eosinofilt granulom 01-01-2012
DC966B Histiocytosis X, unifokal 01-01-2012
DC966C Histiocytosis X UNS 01-01-2012
DC966D Langerhans-celle histiocytose UNS 01-01-2012
DC967 Anden malign neoplasi fra lymfoidt eller hæmatopoietisk væv 01-01-1994
DC967A Histiocytært sarkom 01-01-1994
DC968 Malign histiocytose UNS 01-01-2012
DC969 Malign neoplasi fra lymfoidt eller hæmatopoietisk væv UNS 01-01-1994
DC97 Kræft opstået uafhængigt i flere lokalisationer 01-01-1994 31-12-2010
DC979 Neopl mal primarium flere lokalisationer 01-01-1994 31-12-2010
DC99 Kliniske og parakliniske fund ved kræftsygdom 01-07-2018
DC991 Lokalrecidiv UNS 01-07-2018
DC991A Lokalrecidiv i efterladt væv 01-07-2018
DC991B Lokalrecidiv i marginalzone 01-07-2018
DC991C Lokalrecidiv i hud 01-07-2018
DC991D Lokalrecidiv i slimhinde 01-07-2018
DC991E Lokalrecidiv i bindevæv 01-07-2018
DC991Y Lokalrecidiver i multiple lokalisationer 01-07-2018
DD00 Carcinoma in situ på læber, i mundhule, spiserør, mavesæk 01-01-1994
DD000 Carcinoma in situ på læbe, i mundhulen eller svælget 01-01-1994
DD000A Carcinoma in situ i mundhulen 01-01-1994
DD000B Carcinoma in situ på læbe 01-01-1994
DD000C Carcinoma in situ i svælget 01-01-1994
DD001 Carcinoma in situ i spiserøret 01-01-1994
DD002 Carcinoma in situ i mavesækken 01-01-1994
DD01 Carcinoma in situ i andre og ikke spec. fordøjelsesorganer 01-01-1994
DD010 Carcinoma in situ i tyktarmen 01-01-1994
DD011 Carc in situ rectosigmoidei 01-01-1994 30-09-2008
DD012 Carcinoma in situ i endetarmen 01-01-1994
DD013 Carcinoma in situ i endetarmsåbningen eller analkanalen 01-01-1994
DD013A Carcinoma in situ i endetarmsåbningen 01-01-1994
DD013B Carcinoma in situ i analkanalen 01-01-1994
DD014 Carcinoma in situ i anden eller ikke spec. del af tarmen 01-01-1994
DD014A Carcinoma in situ i tyndtarmen 01-01-2012
DD015 Carcinoma in situ i leveren, galdeblæren eller galdeveje 01-01-1994
DD015A Carcinoma in situ ampullae Vateri 01-01-1994
DD015B Carcinoma in situ i leveren 01-01-1994
DD015C Carcinoma in situ i galdeblæren 01-01-1994
DD015D Carcinoma in situ i galdeveje 01-01-1994
DD017 Carcinoma in situ i fordøjelsesorganer m. anden lokalisation 01-01-1994
DD017A Carcinoma in situ i pancreas 01-01-2012
DD019 Carcinoma in situ i fordøjelseskanalen UNS 01-01-1994
DD02 Carcinoma in situ i mellemøre og åndedrætsorganer 01-01-1994
DD020 Carcinoma in situ i strubehovedet 01-01-1994
DD021 Carcinoma in situ i luftrøret 01-01-1994
DD022 Carcinoma in situ i bronkie eller lunge 01-01-1994
DD022A Carcinoma in situ i bronkie 01-01-1994
DD022B Carcinoma in situ i lunge 01-01-1994
DD023 Carcinoma in situ med anden lokalisation i åndedrætsorganer 01-01-1994
DD023A Carcinoma in situ i mellemøre 01-01-1994
DD023B Carcinoma in situ i næsehulen 01-01-1994
DD023C Carcinoma in situ i bihule 01-01-1994
DD024 Carcinoma in situ i åndedrætsorgan UNS 01-01-1994
DD03 Melanoma in situ 01-01-1994
DD030 Melanoma in situ på læbe 01-01-1994
DD030E Melanoma in situ labii oris, lentigo maligna 01-04-2006 31-12-2011
DD030F Melanoma in situ labii oris, superficielt spredende 01-04-2006 31-12-2011
DD031 Melanoma in situ på øjenlåg 01-01-1994
DD031A Melanoma in situ canthi oculi 01-01-1994
DD031B Melanoma in situ palpebrae 01-01-1994 31-12-2011
DD031E Melanoma in situ palpebrae, lentigo maligna 01-04-2006 31-12-2011
DD031F Melanoma in situ palpebrae, superficielt spredende 01-04-2006 31-12-2011
DD032 Melanoma in situ på øre eller i ydre øregang 01-01-1994
DD032A Melanoma in situ på øre 01-01-1994
DD032B Melanoma in situ i ydre øregang 01-01-1994
DD032C Melanoma in situ meatus acustici externi 01-01-1994 31-12-2011
DD032E Melan. in sit au, can aur ext et mea ac ext, lent mal 01-04-2006 31-12-2011
DD032F Melan. in sit au, can aur ext et mea ac ext, superf. spr 01-04-2006 31-12-2011
DD033 Melanoma in situ i ansigtet m. anden/ikke spec. lokalisation 01-01-1994
DD033A Melanoma in situ på næsen 01-01-2012
DD033E Melan. in sit fac m an el i sp lok, lent mal 01-04-2006 31-12-2011
DD033F Melan. in sit fac m an el i sp lok, superf. spr 01-04-2006 31-12-2011
DD034 Melanoma in situ på skalpen eller halsen 01-01-1994
DD034A Melanoma in situ på skalpen 01-01-1994
DD034B Melanoma in situ på halsen 01-01-1994
DD034E Melanoma in situ capillitii et colli, lentigo maligna 01-04-2006 31-12-2011
DD034F Melanoma in situ capillitii et colli, superficielt spredende 01-04-2006 31-12-2011
DD035 Melanoma in situ på kroppen 01-01-1994
DD035A Melanoma in situ (i hud) ved endetarmsåbningen 01-01-1994
DD035B Melanoma in situ på bryst 01-01-1994
DD035C Melanoma in situ i marginalzonen i endetarmsåbningen 01-01-1994
DD035D Melanoma in situ cervicis uteri 01-10-2003 31-12-2011
DD035E Melanoma in situ trunci, lentigo maligna 01-04-2006 31-12-2011
DD035F Melanoma in situ trunci, superficielt spredende 01-04-2006 31-12-2011
DD035G Melanoma in situ i vulva 01-01-2012
DD036 Melanoma in situ på overekstremitet 01-01-1994
DD036A Melanoma in situ på skulder 01-01-1994
DD036B Melanoma in situ på arm 01-01-1994
DD036E Melanoma in situ extremitatis superioris, lentigo maligna 01-04-2006 31-12-2011
DD036F Melan. in situ extr. superioris, superf. spr 01-04-2006 31-12-2011
DD037 Melanoma in situ på underekstremitet 01-01-1994
DD037A Melanoma in situ på ben 01-01-1994
DD037B Melanoma in situ på hofte 01-01-1994
DD037E Melanoma in situ extremitatis inferioris, lentigo maligna 01-04-2006 31-12-2011
DD037F Melan. in situ extr. inferioris, superf. spr 01-04-2006 31-12-2011
DD038 Melanoma in situ med anden lokalisation 01-01-1994
DD038E Melanoma in situ med anden lokalisation, lentigo maligna 01-04-2006 31-12-2011
DD038F Melan. in situ med anden lokalisation, superf. spr 01-04-2006 31-12-2011
DD039 Melanoma in situ UNS 01-01-1994
DD039E Melanoma in situ non spec. , lentigo maligna 01-04-2006 31-12-2011
DD039F Melanoma in situ non spec. , superficielt spredende 01-04-2006 31-12-2011
DD04 Carcinoma in situ i huden 01-01-1994
DD040 Carcinoma in situ i hud på læbe 01-01-1994
DD040E Carcinoma in situ cutis labii, bowenoid papulose 01-04-2006 31-12-2011
DD040G Carcinoma in situ cutis labii, recidivans 01-04-2006 31-12-2011
DD040Z Carcinoma in situ cutis labii, andet 01-04-2006 31-12-2011
DD041 Carcinoma in situ i hud på øjenlåg 01-01-1994
DD041A Carcinoma in situ i hud i øjenkrog 01-01-1994
DD041B Carc in situ cutis palpebrae 01-01-1994 31-12-2011
DD041D Carcinoma in situ cutis palpebrae, mb. Bowen 01-04-2006 31-12-2011
DD041E Carcinoma in situ cutis palpebrae, bowenoid papulose 01-04-2006 31-12-2011
DD041G Carcinoma in situ cutis palpebrae, recidivans 01-04-2006 31-12-2011
DD041Z Carcinoma in situ cutis palpebrae, andet 01-04-2006 31-12-2011
DD042 Carcinoma in situ i hud på øre eller i ydre øregang 01-01-1994
DD042A Carcinoma in situ i hud på øre 01-01-1994
DD042B Carcinoma in situ i hud i ydre øregang 01-01-1994
DD042C Carc in situ meatus acustici externi 01-01-1994 31-12-2011
DD042D Car. in sit cut au, can aur ext et mea ac ext, mb. Bowen 01-04-2006 31-12-2011
DD042E Car. in sit cut au, can aur ext et mea ac ext, bow papulose 01-04-2006 31-12-2011
DD042G Car. in sit cut au, can aur ext et mea ac ext, rec. 01-04-2006 31-12-2011
DD042Z Car. in sit cut. auris, can aur ext et meat acus externi, an 01-04-2006 31-12-2011
DD043 Carcinoma in situ i hud i ansigtet med an./ikke spec. lokal. 01-01-1994
DD043A Carcinoma in situ i hud i ansigtet med anden lokalisation 01-01-1994
DD043B Carcinoma in situ i hud i ansigtet UNS 01-01-1994
DD043C Carcinoma in situ i hud på næsen 01-01-2012
DD043D Car. in sit cut. fac med anden el i spec. lok. , mb. Bowen 01-04-2006 31-12-2011
DD043E Car. in sit cut fac m an el i sp lok. , bow papulose 01-04-2006 31-12-2011
DD043G Car. in situ cut. faciei med anden el i spec. lok. , rec. 01-04-2006 31-12-2011
DD043Z Car. in situ cut. faciei med anden el i spec. lok. , an 01-04-2006 31-12-2011
DD044 Carcinoma in situ i hud på skalpen eller halsen 01-01-1994
DD044A Carcinoma in situ i hud på skalpen 01-01-1994
DD044B Carcinoma in situ i hud på halsen 01-01-1994
DD044D Carcinoma in situ cutis capillitii et colli, mb. Bowen 01-04-2006 31-12-2011
DD044E Car. in situ cut. capillitii et colli, bowenoid papulose 01-04-2006 31-12-2011
DD044G Carcinoma in situ cutis capillitii et colli, recidivans 01-04-2006 31-12-2011
DD044Z Carcinoma in situ cutis capillitii et colli, andet 01-04-2006 31-12-2011
DD045 Carcinoma in situ i hud på kroppen 01-01-1994
DD045A Carcinoma in situ i hud ved endetarmsåbningen 01-01-1994
DD045B Carcinoma in situ i hud på bryst 01-01-1994
DD045C Carcinoma in situ i marginalzonen i endetarmsåbningen 01-01-1994
DD045D Carcinoma in situ cutis trunci, mb. Bowen 01-04-2006 31-12-2011
DD045E Carcinoma in situ cutis trunci, bowenoid papulose 01-04-2006 31-12-2011
DD045G Carcinoma in situ cutis trunci, recidivans 01-04-2006 31-12-2011
DD045Z Carcinoma in situ cutis trunci, andet 01-04-2006 31-12-2011
DD046 Carcinoma in situ i hud på overekstremitet 01-01-1994
DD046A Carcinoma in situ i hud på skulder 01-01-1994
DD046B Carcinoma in situ i hud på arm 01-01-1994
DD046D Carcinoma in situ cutis extremitatis superioris, mb. Bowen 01-04-2006 31-12-2011
DD046E Car. in situ cut. extr. superioris, bowenoid papulose 01-04-2006 31-12-2011
DD046G Carcinoma in situ cutis extremitatis superioris, recidivans 01-04-2006 31-12-2011
DD046Z Carcinoma in situ cutis extremitatis superioris, andet 01-04-2006 31-12-2011
DD047 Carcinoma in situ i hud på underekstremitet 01-01-1994
DD047A Carcinoma in situ i hud på ben 01-01-1994
DD047B Carcinoma in situ i hud på hofte 01-01-1994
DD047D Carcinoma in situ cutis extremitatis inferioris, mb. Bowen 01-04-2006 31-12-2011
DD047E Car. in situ cut. extr. inferioris, bowenoid papulose 01-04-2006 31-12-2011
DD047G Carcinoma in situ cutis extremitatis inferioris, recidivans 01-04-2006 31-12-2011
DD047Z Carcinoma in situ cutis extremitatis inferioris, andet 01-04-2006 31-12-2011
DD048 Carcinoma in situ i huden med anden lokalisation 01-01-1994
DD048D Carcinoma in situ cutis med anden lokalisation, mb. Bowen 01-04-2006 31-12-2011
DD048E Car. in situ cut. med anden lokalisation, bowenoid papulose 01-04-2006 31-12-2011
DD048G Carcinoma in situ cutis med anden lokalisation, recidivans 01-04-2006 31-12-2011
DD048Z Carcinoma in situ cutis med anden lokalisation, andet 01-04-2006 31-12-2011
DD049 Carcinoma in situ i huden UNS 01-01-1994
DD049D Carcinoma in situ cutis non spec. , mb. Bowen 01-04-2006 31-12-2011
DD049E Carcinoma in situ cutis non spec. , bowenoid papulose 01-04-2006 31-12-2011
DD049G Carcinoma in situ cutis non spec. , recidivans 01-04-2006 31-12-2011
DD049Z Carcinoma in situ cutis non spec. , andet 01-04-2006 31-12-2011
DD05 Carcinoma in situ i bryst 01-01-1994
DD050 Lobulært carcinoma in situ i mamma 01-01-1994
DD051 Intraduktalt carcinoma in situ i mamma 01-01-1994
DD056 Pagets sygdom i bryst (brystvorte) 01-01-2010
DD057 Carcinoma in situ med anden lokalisation i mamma 01-01-1994
DD059 Carcinoma in situ i mamma UNS 01-01-1994
DD06 Carcinoma in situ i livmoderhalsen 01-01-1994
DD060 Carc in situ endocervicis uteri 01-01-1994 31-12-2005
DD061 Carc in situ exocervicis uteri 01-01-1994 31-12-2005
DD067 Carc in situ cervicis uteri m anden lokalisation 01-01-1994 31-12-2005
DD069 Carcinoma in situ i livmoderhalsen UNS 01-01-1994
DD07 Carcinoma in situ m an/ikke spec. lokalisation i kønsorganer 01-01-1994
DD070 Endometriehyperplasi med atypi 01-01-1994
DD071 Carcinoma in situ i vulva 01-01-1994
DD071A Vulvær intraepitelial neoplasi (VIN), grad III 01-01-2012
DD071D Carcinoma in situ vulvae, mb. Bowen 01-04-2006 30-09-2009
DD071E Carcinoma in situ vulvae, bowenoid papulose 01-04-2006 30-09-2009
DD071G Carcinoma in situ vulvae, recidivans 01-04-2006 30-09-2009
DD071Z Carcinoma in situ vulvae, andet 01-04-2006 30-09-2009
DD072 Carcinoma in situ i vagina 01-01-1994
DD072A Vaginal intraepitelial neoplasi (VAIN), grad III 01-01-2012
DD073 Carcinoma in situ m an/ikke spec. lokal. i kvind.kønsorganer 01-01-1994
DD073A Carcinoma in situ i æggestok 01-01-2012
DD073B Carcinoma in situ m. an. lokalisation i kvindeligt kønsorgan 01-01-2012
DD073B1 Tubalt intraepithelialt karcinom 01-10-2020
DD073C Carcinoma in situ i kvindeligt kønsorgan UNS 01-01-2012
DD074 Carcinoma in situ på penis 01-01-1994
DD074D Carcinoma in situ penis, mb. Bowen 01-04-2006 31-12-2011
DD074E Carcinoma in situ penis, bowenoid papulose 01-04-2006 31-12-2011
DD074G Carcinoma in situ penis, recidivans 01-04-2006 31-12-2011
DD074Z Carcinoma in situ penis, andet 01-04-2006 31-12-2011
DD075 Carcinoma in situ i prostata 01-01-1994
DD076 Carcinoma in situ m an/ikke spec. lokal. i mand. kønsorganer 01-01-1994
DD076A Carcinoma in situ med an. lokalisation i mandligt kønsorgan 01-01-1994
DD076B Carcinoma in situ i mandligt kønsorgan UNS 01-01-1994
DD076T Carcinoma in situ i testikel 01-01-2000
DD09 Carcinoma in situ med andre eller ikke spec. lokalisationer 01-01-1994
DD090 Carcinoma in situ (Tis) i urinblæren 01-01-1994
DD091 Carcinoma in situ (Tis) med anden/ikke spec. lok. i urinveje 01-01-1994
DD091A Carcinoma in situ i nyre 01-01-2010
DD091B Carcinoma in situ i nyrebækken 01-01-2010
DD091C Carcinoma in situ i urinleder 01-01-2010
DD091D Carcinoma in situ i urinrør 01-01-2010
DD092 Carcinoma in situ i øje 01-01-1994
DD093 Carcinoma in situ i endokrin kirtel 01-01-1994
DD093A Carcinoma in situ i skjoldbruskkirtlen 01-01-1994
DD093B Carcinoma in situ i anden endokrin kirtel 01-01-1994
DD095 Non-invasiv papillær tumor (Ta) i urinblæren 01-01-2016
DD096 Non-invasiv papillær tumor (Ta) i an/ikke spc lok i urinveje 01-01-2016
DD096B Non-invasiv papillær tumor (Ta) i nyrebækken 01-01-2016
DD096C Non-invasiv papillær tumor (Ta) i urinleder 01-01-2016
DD096D Non-invasiv papillær tumor (Ta) i urinrøret 01-01-2016
DD097 Carcinoma in situ med anden lokalisation 01-01-1994
DD097A Carcinoma in situ på næsen UNS 01-01-2012
DD099 Carcinoma in situ UNS 01-01-1994
DD10 Godartede tumorer i læber, mundhulen og svælget 01-01-1994
DD100 Godartet tumor i læbe 01-01-1994
DD101 Godartet tumor i tungen 01-01-1994
DD101A Godartet tumor i tonsilla lingualis 01-01-1994
DD102 Godartet tumor i mundgulvet 01-01-1994
DD103 Godartet tumor i mundhulen m. anden/ikke spec. lokalisation 01-01-1994
DD103A Godartet tumor i munden UNS 01-01-1994
DD103B Papillomatosis mucosae facies oralis palati 01-01-2000
DD104 Godartet tumor i tonsil 01-01-1994
DD104A Godartet tumor i tonsilla palatina 01-01-1994
DD105 Godartet tumor med anden lokalisation i mundsvælget 01-01-1994
DD106 Godartet tumor i næsesvælget 01-01-1994
DD106A Juvenilt angiofibrom i rhinopharynx 01-07-2012
DD107 Godartet tumor i hypopharynx 01-01-1994
DD109 Godartet tumor i svælget UNS 01-01-1994
DD11 Godartede tumorer i store spytkirtler 01-01-1994
DD110 Godartet tumor i ørespytkirtel 01-01-1994
DD117 Godartet tumor i anden stor spytkirtel 01-01-1994
DD117A Godartet tumor i glandula sublingualis 01-01-1994
DD117B Godartet tumor i glandula submandibularis 01-01-1994
DD119 Godartet tumor i stor spytkirtel UNS 01-01-1994
DD12 Godartet tumor i tyktarmen, endetarmen, endetarmsåbning 01-01-1994
DD120 Godartet tumor i caecum 01-01-1994
DD120A Godartet tumor i valvula ileocaecalis 01-01-1994
DD121 Godartet tumor i blindtarmen 01-01-1994
DD122 Godartet tumor i colon ascendens 01-01-1994
DD123 Godartet tumor i colon transversum 01-01-1994
DD123A Godartet tumor i flexura coli dextra 01-01-1994
DD123B Godartet tumor i flexura coli sinistra 01-01-1994
DD124 Godartet tumor i colon descendens 01-01-1994
DD125 Godartet tumor i colon sigmoideum 01-01-1994
DD126 Godartet tumor i tyktarm u spec. lokal. 01-01-1994
DD126A Adenomatosis coli 01-01-1994
DD126B Polyposis hereditaria coli 01-01-1994
DD126C Multiple godartede tumorer i tyktarmen 01-01-1994
DD126F Familiær adenomatøs polypose (FAP) 01-01-2004
DD127 Neopl ben rectosigmoidei 01-01-1994 30-09-2008
DD128 Godartet tumor i endetarmen 01-01-1994
DD129 Godartet tumor i endetarmsåbningen eller analkanalen 01-01-1994
DD129A Godartet tumor i endetarmsåbningen 01-01-1994
DD129B Godartet tumor i analkanalen 01-01-1994
DD13 Godartet tumor i an/dårligt spec. dele af fordøjelsessystem 01-01-1994
DD130 Godartet tumor i spiserøret 01-01-1994
DD131 Godartet tumor i mavesækken 01-01-1994
DD132 Godartet tumor i tolvfingertarmen 01-01-1994
DD133 Godartet tumor i anden eller ikke spec. del af tyndtarmen 01-01-1994
DD133A Neopl ben intestini tenuis uden lokalisation 01-01-1994 31-12-2011
DD134 Godartet tumor i leveren 01-01-1994
DD134A Godartet tumor i intrahepatiske galdegange 01-01-1994
DD135 Godartet tumor i ekstrahepatiske galdeveje 01-01-1994
DD136 Godartet tumor i pancreas 01-01-1994
DD137 Godartet tumor i Langerhanske øer 01-01-1994
DD137A Insulinom 01-01-1994
DD137B Glucagonom 01-04-2000
DD139 Godartet tumor i fordøjelsessystemet UNS 01-01-1994
DD139A Godartet tumor i milten UNS 01-01-2012
DD14 Godartede tumorer i mellemøre og åndedrætsorganer 01-01-1994
DD140 Godartet tumor i mellemøre, næsehulen eller bihule 01-01-1994
DD140A Godartet tumor i mellemøre 01-01-1994
DD140B Godartet tumor i næsehulen 01-01-1994
DD140C Godartet tumor i bihule 01-01-1994
DD140D Godartet tumor i næsebrusken 01-01-2012
DD141 Godartet tumor i strubehovedet 01-01-1994
DD142 Godartet tumor i luftrøret 01-01-1994
DD143 Godartet tumor i bronkie eller lunge 01-01-1994
DD143A Godartet tumor i bronkie 01-01-1994
DD143B Godartet tumor i lunge 01-01-1994
DD144 Godartet tumor i åndedrætsorgan UNS 01-01-1994
DD15 Godartet tumor i an/dårligt spec. lokalisationer i brysthule 01-01-1994
DD150 Godartet tumor i thymus 01-01-1994
DD151 Godartet tumor i hjertet 01-01-1994
DD152 Godartet tumor i mediastinum 01-01-1994
DD157 Godartet tumor i andet organ i brysthulen 01-01-1994
DD159 Godartet tumor i brysthulen UNS 01-01-1994
DD16 Godartede tumorer i knogle og ledbrusk 01-01-1994
DD160 Godartet tumor i knogle/ledbrusk i skulderblad/lang armknog. 01-01-1994
DD160A Neopl ben cartilaginis articuli ossium longorum extr sup 01-01-1994 31-12-2011
DD160B Neopl ben cartilaginis articuli scapulae 01-01-1994 31-12-2011
DD160C Godartet tumor i knogle eller ledbrusk i lang knogle i arm 01-01-1994
DD160D Godartet tumor i knogle eller ledbrusk i skulderblad 01-01-1994
DD161 Godartet tumor i knogle eller ledbrusk i kort knogle i arm 01-01-1994
DD161A Neopl ben cartilaginis articuli ossium brevium extr 01-01-1994 31-12-2011
DD161B Neopl ben ossium brevium extremitatis superioris 01-01-1994 31-12-2011
DD162 Godartet tumor i knogle eller ledbrusk i lang knogle i ben 01-01-1994
DD162A Neopl ben cartilaginis articuli ossium longorum extr inf 01-01-1994 31-12-2011
DD162B Neopl ben ossium longorum extremitatis inferioris 01-01-1994 31-12-2011
DD163 Godartet tumor i knogle eller ledbrusk i kort knogle i ben 01-01-1994
DD163A Neopl ben cartilaginis articuli ossium brevium extremitatis 01-01-1994 31-12-2011
DD163B Neopl ben ossium brevium extremitatis inferioris 01-01-1994 31-12-2011
DD163C Eksostose under tånegl 01-04-2000
DD164 Godartet tumor i knogle eller ledbrusk i kranie eller ansigt 01-01-1994
DD164A Neopl ben cartilaginis articuli ossis cranii 01-01-1994 31-12-2011
DD164B Neopl ben cartilaginis articuli ossis faciei 01-01-1994 31-12-2011
DD164C Godartet tumor i knogle eller ledbrusk i kranieknogle 01-01-1994
DD164D Godartet tumor i knogle eller ledbrusk i ansigtsknogle 01-01-1994
DD164E Godartet tumor i knogle eller ledbrusk i overkæben 01-01-2012
DD165 Godartet tumor i knogle eller ledbrusk i underkæben 01-01-1994
DD165A Neopl ben cartilaginis articuli mandibulae 01-01-1994 31-12-2011
DD166 Godartet tumor i knogle eller ledbrusk i rygsøjlen 01-01-1994
DD166A Neopl ben cartilaginis articuli columnae vertebralis 01-01-1994 31-12-2011
DD166B Neopl ben columnae vertebralis 01-01-1994 31-12-2011
DD167 Godartet tumor i knogle/ledbr i ribben, brystben, clavicula 01-01-1994
DD167A Neopl ben cartilaginis articuli claviculae 01-01-1994 31-12-2011
DD167B Neopl ben cartilaginis articuli costae 01-01-1994 31-12-2011
DD167C Neopl ben cartilaginis articuli sterni 01-01-1994 31-12-2011
DD167D Godartet tumor i knogle eller ledbrusk i clavicula 01-01-1994
DD167E Godartet tumor i knogle eller ledbrusk i ribben 01-01-1994
DD167F Godartet tumor i knogle eller ledbrusk i brystbenet 01-01-1994
DD168 Godartet tumor i knogle/ledbr i bækken, korsben, haleben 01-01-1994
DD168A Neopl ben cartilaginis articuli ossis coccygis 01-01-1994 31-12-2011
DD168B Neopl ben cartilaginis articuli ossis pelvis 01-01-1994 31-12-2011
DD168C Neopl ben cartilaginis articuli ossis sacri 01-01-1994 31-12-2011
DD168D Godartet tumor i knogle eller ledbrusk i os coccygis 01-01-1994
DD168E Godartet tumor i knogle eller ledbrusk i bækkenet 01-01-1994
DD168F Godartet tumor i knogle eller ledbrusk i os sacrum 01-01-1994
DD169 Godartet tumor i knogle eller ledbrusk UNS 01-01-1994
DD169A Neopl ben cartilaginis articuli uden specifikation 01-01-1994 31-12-2011
DD169B Neopl ben ossis uden specifikation 01-01-1994 31-12-2011
DD17 Lipomer 01-01-1994
DD170 Lipom i hud eller underhud på hoved, ansigt eller hals 01-01-1994
DD170A Lipom i hud på hovedet 01-01-1994
DD170B Lipom i hud på halsen 01-01-1994
DD170C Lipom i hud på ansigtet 01-01-1994
DD170D Lipom i underhud på hovedet 01-01-1994
DD170E Lipom i underhud på halsen 01-01-1994
DD170F Lipom i underhud på ansigtet 01-01-1994
DD171 Lipom i hud eller underhud på kroppen 01-01-1994
DD171A Neopl ben lipomatosum cutis trunci 01-01-1994 31-12-2011
DD171B Neopl ben lipomatosum subcutis trunci 01-01-1994 31-12-2011
DD171C Lipom i hud eller underhud på mamma 01-01-2012
DD172 Lipom i hud eller underhud på ekstremitet 01-01-1994
DD172A Neopl ben lipomatosum cutis extremitatum 01-01-1994 31-12-2011
DD172B Neopl ben lipomatosum subcutis extremitatum 01-01-1994 31-12-2011
DD173 Lipom i hud el. underhud m. an. el. ikke spec. lokalisation 01-01-1994
DD173A Neopl ben lipomatosum cutis uden lokalisation 01-01-1994 31-12-2011
DD173B Neopl ben lipomatosum subcutis uden lokalisation 01-01-1994 31-12-2011
DD174 Lipom i intratorakalt organ 01-01-1994
DD175 Lipom i intraabdominalt organ 01-01-1994
DD176 Lipom i sædstrengen 01-01-1994
DD177 Lipom med anden lokalisation 01-01-1994
DD177A Peritonealt lipom 01-01-1994
DD177B Retroperitonealt lipom 01-01-1994
DD177C Lipom i mamma 01-01-2012
DD179 Lipom UNS 01-01-1994
DD18 Godartede tumorer i blodkar og lymfekar 01-01-1994
DD180 Hæmangiom 01-01-1994
DD180A Intrakutant hæmangiom 01-04-2000
DD180B Blue rubber bleb-nævus 01-04-2000
DD180C Kimuras sygdom 01-04-2000
DD180D Diffust hæmangiom 01-04-2000
DD180E Kasabach-Merritt syndrom 01-04-2000
DD180F Kapillært hæmangiom 01-04-2000
DD181 Lymfangiom 01-01-1994
DD181A Hygroma 01-04-2000
DD181B Lymfhæmangiom 01-04-2000
DD189 Godartet tumor i blodkar eller lymfekar UNS 01-01-2004
DD19 Godartede tumorer i mesotelialt væv 01-01-1994
DD190 Godartet mesoteliom i lungehinde 01-01-1994
DD191 Godartet mesoteliom i peritoneum 01-01-1994
DD192 Mesothelioma extremitatum incl. cingulum og regio coxae 01-01-1994 30-09-2007
DD192A Mesothelioma ben extremitatis inferioris 01-01-1994 30-09-2007
DD192B Mesothelioma ben extremitatis superioris 01-01-1994 30-09-2007
DD192C Mesothelioma ben regionis cinguli 01-01-1994 30-09-2007
DD192D Mesothelioma ben regionis coxae 01-01-1994 30-09-2007
DD193 Mesothelioma thoracis 01-01-1994 30-09-2007
DD194 Mesothelioma abdominis 01-01-1994 30-09-2007
DD195 Mesothelioma pelvis 01-01-1994 30-09-2007
DD196 Mesothelioma trunci uden specifikation 01-01-1994 30-09-2007
DD197 Godartet tumor i mesotelialt væv med anden lokalisation 01-01-1994
DD199 Godartet tumor i mesotelialt væv UNS 01-01-1994
DD20 Godartede tumorer i bindevæv i peritoneum og retroperitoneum 01-01-1994
DD200 Godartet tumor i bindevæv i retroperitoneum 01-01-1994
DD201 Godartet tumor i bindevæv i peritoneum 01-01-1994
DD21 Andre godartede tumorer i bindevæv og andre bløddele 01-01-1994
DD210 Godartet tumor i bindevæv/an. bløddele i hoved, ansigt, hals 01-01-1994
DD210A Godartet tumor i bindevæv i hovedet 01-01-1994
DD210B Godartet tumor i bindevæv i halsen 01-01-1994
DD210C Godartet tumor i bindevæv i ansigtet 01-01-1994
DD211 Godartet tumor i bindevæv i overekstremitet 01-01-1994
DD211A Godartet tumor i bindevæv i skulder 01-01-1994
DD211B Neopl ben telae conjunctivae extremitatis superioris 01-01-1994 31-12-2011
DD212 Godartet tumor i bindevæv i underekstremitet 01-01-1994
DD212A Neopl ben telae conjunctivae extremitatis inferioris 01-01-1994 31-12-2011
DD212B Godartet tumor i bindevæv i hofte 01-01-1994
DD213 Godartet tumor i bindevæv i thorax 01-01-1994
DD214 Godartet tumor i bindevæv i abdomen 01-01-1994
DD215 Godartet tumor i bindevæv i bækkenet 01-01-1994
DD216 Godartet tumor i bindevæv i kroppen UNS 01-01-1994
DD216A Godartet tumor i bindevæv på ryggen 01-01-2012
DD217 Godartet tumor i bindevæv med anden lokalisation 01-01-1994
DD217A Xanthofibrom 01-04-2000 31-12-2011
DD219 Godartet tumor i bindevæv UNS 01-01-1994
DD22 Nævus 01-01-1994
DD220 Nævus på læbe 01-01-1994
DD220D Naevus melanocyticus labii, compositus 01-04-2006 31-12-2011
DD220E Naevus melanocyticus labii, congenitus 01-04-2006 31-12-2011
DD220F Naevus melanocyticus labii, coeruleus (blue) 01-04-2006 31-12-2011
DD220G Naevus melanocyticus labii, dermalis (intradermalt) 01-04-2006 31-12-2011
DD220H Naevus melanocyticus labii, dysplastisk (atypisk) 01-04-2006 31-12-2011
DD220K Naevus melanocyticus labii, gigant (Tierfell) 01-04-2006 31-12-2011
DD220L Naevus melanocyticus labii, halo naevus 01-04-2006 31-12-2011
DD220M Naevus melanocyticus labii, Ito naevus 01-04-2006 31-12-2011
DD220N Naevus melanocyticus labii, Ota naevus 01-04-2006 31-12-2011
DD220P Naevus melanocyticus labii, Spitz' naevus 01-04-2006 31-12-2011
DD220Q Naevus melanocyticus labii, naevus spilus 01-04-2006 31-12-2011
DD220V Naevus melanocyticus labii, junctionalis (intraepidermalt) 01-04-2006 31-12-2011
DD220Z Naevus melanocyticus labii, andet 01-04-2006 31-12-2011
DD221 Nævus på øjenlåg 01-01-1994
DD221A Naevus melanocyticus canthi oculi 01-01-1994 31-12-2011
DD221B Naevus melanocyticus palpebrae 01-01-1994 31-12-2011
DD221D Naevus melanocyticus palpebrae, compositus 01-04-2006 31-12-2011
DD221E Naevus melanocyticus palpebrae, congenitus 01-04-2006 31-12-2011
DD221F Naevus melanocyticus palpebrae, coeruleus (blue) 01-04-2006 31-12-2011
DD221G Naevus melanocyticus palpebrae, dermalis (intradermalt) 01-04-2006 31-12-2011
DD221H Naevus melanocyticus palpebrae, dysplastisk (atypisk) 01-04-2006 31-12-2011
DD221K Naevus melanocyticus palpebrae, gigant (Tierfell) 01-04-2006 31-12-2011
DD221L Naevus melanocyticus palpebrae, halo naevus 01-04-2006 31-12-2011
DD221M Naevus melanocyticus palpebrae, Ito naevus 01-04-2006 31-12-2011
DD221N Naevus melanocyticus palpebrae, Ota naevus 01-04-2006 31-12-2011
DD221P Naevus melanocyticus palpebrae, Spitz' naevus 01-04-2006 31-12-2011
DD221Q Naevus melanocyticus palpebrae, naevus spilus 01-04-2006 31-12-2011
DD221V Naevus melanoc. palpebrae, junctionalis (intraepid.) 01-04-2006 31-12-2011
DD221Z Naevus melanocyticus palpebrae, andet 01-04-2006 31-12-2011
DD222 Nævus på øre eller i ydre øregang 01-01-1994
DD222A Nævus på øre 01-01-1994
DD222B Nævus i ydre øregang 01-01-1994
DD222D Naevus melanoc. auris et canalis auris externi, comp. 01-04-2006 31-12-2011
DD222E Naevus melanoc. auris et canalis auris externi, cong. 01-04-2006 31-12-2011
DD222F Naev melanoc. aur et can auris externi, coeruleus (blue) 01-04-2006 31-12-2011
DD222G Naev melanoc. aur et can aur ext, derm (intraderm.) 01-04-2006 31-12-2011
DD222H Naev melanoc. aur et can aur ext, dysplastisk (atyp) 01-04-2006 31-12-2011
DD222K Naev melanoc. aur et can auris externi, gigant (Tierfell) 01-04-2006 31-12-2011
DD222L Naevus melanoc. auris et canalis auris externi, halo naevus 01-04-2006 31-12-2011
DD222M Naevus melanoc. auris et canalis auris externi, Ito naevus 01-04-2006 31-12-2011
DD222N Naevus melanoc. auris et canalis auris externi, Ota naevus 01-04-2006 31-12-2011
DD222P Naev melanoc. auris et canalis auris externi, Spitz' naevus 01-04-2006 31-12-2011
DD222Q Naev melanoc. aur et can auris externi, naevus spilus 01-04-2006 31-12-2011
DD222V Naev melanoc. aur et can aur ext, junct (intraepid.) 01-04-2006 31-12-2011
DD222Z Naevus melanocyticus auris et canalis auris externi, andet 01-04-2006 31-12-2011
DD223 Nævus med anden eller ikke spec. lokalisation i ansigtet 01-01-1994
DD223A Naevus melanocyticus faciei uden specifikation 01-01-1994 31-12-2011
DD223D Naevus melanoc. faciei med anden el i spec. lok. , comp. 01-04-2006 31-12-2011
DD223E Naevus melanoc. faciei med anden el i spec. lok. , cong. 01-04-2006 31-12-2011
DD223F Naev melanoc. fac m an el i sp lok. , coeruleus (blue) 01-04-2006 31-12-2011
DD223G Naev melanoc. fac m an el i sp lok. , derm (intraderm.) 01-04-2006 31-12-2011
DD223H Naev melanoc. fac m an el i sp lok. , dysplastisk (atyp) 01-04-2006 31-12-2011
DD223K Naev melanoc. fac m an el i sp lok. , gigant (Tierfell) 01-04-2006 31-12-2011
DD223L Naev melanoc. fac med anden el i spec. lok. , halo naevus 01-04-2006 31-12-2011
DD223M Naev melanoc. fac med anden el i spec. lok. , Ito naevus 01-04-2006 31-12-2011
DD223N Naev melanoc. fac med anden el i spec. lok. , Ota naevus 01-04-2006 31-12-2011
DD223P Naev melanoc. fac m anden el ikke spec. lok., Spitz' naevus 01-04-2006 31-12-2011
DD223Q Naev melanoc. fac med anden el i spec. lok. , naevus spilus 01-04-2006 31-12-2011
DD223V Naev melanoc. fac m an el i sp lok. , junct (intraepid.) 01-04-2006 31-12-2011
DD223Z Naevus melanoc. faciei med anden el i spec. lok. , an 01-04-2006 31-12-2011
DD224 Nævus på skalpen eller halsen 01-01-1994
DD224A Nævus på skalpen 01-01-1994
DD224B Nævus på halsen 01-01-1994
DD224D Naevus melanocyticus capillitii et colli, compositus 01-04-2006 31-12-2011
DD224E Naevus melanocyticus capillitii et colli, congenitus 01-04-2006 31-12-2011
DD224F Naevus melanocyticus capillitii et colli, coeruleus (blue) 01-04-2006 31-12-2011
DD224G Naevus melanoc. capillitii et colli, dermalis (intraderm.) 01-04-2006 31-12-2011
DD224H Naevus melanoc. capillitii et colli, dysplastisk (atypisk) 01-04-2006 31-12-2011
DD224K Naevus melanocyticus capillitii et colli, gigant (Tierfell) 01-04-2006 31-12-2011
DD224L Naevus melanocyticus capillitii et colli, halo naevus 01-04-2006 31-12-2011
DD224M Naevus melanocyticus capillitii et colli, Ito naevus 01-04-2006 31-12-2011
DD224N Naevus melanocyticus capillitii et colli, Ota naevus 01-04-2006 31-12-2011
DD224P Naevus melanocyticus capillitii et colli, Spitz' naevus 01-04-2006 31-12-2011
DD224Q Naevus melanocyticus capillitii et colli, naevus spilus 01-04-2006 31-12-2011
DD224V Naev melanoc. capillitii et colli, junctionalis (intraepid.) 01-04-2006 31-12-2011
DD224Z Naevus melanocyticus capillitii et colli, andet 01-04-2006 31-12-2011
DD225 Nævus på kroppen 01-01-1994
DD225A Nævus i anus 01-01-1994
DD225B Nævus på mamma 01-01-1994
DD225C Perianalt nævus 01-01-1994
DD225D Naevus melanocyticus trunci, compositus 01-04-2006 31-12-2011
DD225E Naevus melanocyticus trunci, congenitus 01-04-2006 31-12-2011
DD225F Naevus melanocyticus trunci, coeruleus (blue) 01-04-2006 31-12-2011
DD225G Naevus melanocyticus trunci, dermalis (intradermalt) 01-04-2006 31-12-2011
DD225H Naevus melanocyticus trunci, dysplastisk (atypisk) 01-04-2006 31-12-2011
DD225K Naevus melanocyticus trunci, gigant (Tierfell) 01-04-2006 31-12-2011
DD225L Naevus melanocyticus trunci, halo naevus 01-04-2006 31-12-2011
DD225M Naevus melanocyticus trunci, Ito naevus 01-04-2006 31-12-2011
DD225N Naevus melanocyticus trunci, Ota naevus 01-04-2006 31-12-2011
DD225P Naevus melanocyticus trunci, Spitz' naevus 01-04-2006 31-12-2011
DD225Q Naevus melanocyticus trunci, naevus spilus 01-04-2006 31-12-2011
DD225V Naevus melanocyticus trunci, junctionalis (intraepidermalt) 01-04-2006 31-12-2011
DD225Z Naevus melanocyticus trunci, andet 01-04-2006 31-12-2011
DD226 Nævus på overekstremitet 01-01-1994
DD226A Nævus på skulder 01-01-1994
DD226B Naevus melanocyticus extremitatis superioris 01-01-1994 31-12-2011
DD226D Naevus melanocyticus extremitatis superioris, compositus 01-04-2006 31-12-2011
DD226E Naevus melanocyticus extremitatis superioris, congenitus 01-04-2006 31-12-2011
DD226F Naevus melanoc. extr. superioris, coeruleus (blue) 01-04-2006 31-12-2011
DD226G Naevus melanoc. extr. superioris, dermalis (intraderm.) 01-04-2006 31-12-2011
DD226H Naevus melanoc. extr. superioris, dysplastisk (atypisk) 01-04-2006 31-12-2011
DD226K Naevus melanoc. extr. superioris, gigant (Tierfell) 01-04-2006 31-12-2011
DD226L Naevus melanocyticus extremitatis superioris, halo naevus 01-04-2006 31-12-2011
DD226M Naevus melanocyticus extremitatis superioris, Ito naevus 01-04-2006 31-12-2011
DD226N Naevus melanocyticus extremitatis superioris, Ota naevus 01-04-2006 31-12-2011
DD226P Naevus melanocyticus extremitatis superioris, Spitz' naevus 01-04-2006 31-12-2011
DD226Q Naevus melanocyticus extremitatis superioris, naevus spilus 01-04-2006 31-12-2011
DD226V Naevus melanoc. extr. superioris, junctionalis (intraepid.) 01-04-2006 31-12-2011
DD226Z Naevus melanocyticus extremitatis superioris, andet 01-04-2006 31-12-2011
DD227 Nævus på underekstremitet 01-01-1994
DD227A Nævus på hofte 01-01-1994
DD227B Naevus melanocyticus extremitatis inferioris 01-01-1994 31-12-2011
DD227D Naevus melanocyticus extremitatis inferioris, compositus 01-04-2006 31-12-2011
DD227E Naevus melanocyticus extremitatis inferioris, congenitus 01-04-2006 31-12-2011
DD227F Naevus melanoc. extr. inferioris, coeruleus (blue) 01-04-2006 31-12-2011
DD227G Naevus melanoc. extr. inferioris, dermalis (intraderm.) 01-04-2006 31-12-2011
DD227H Naevus melanoc. extr. inferioris, dysplastisk (atypisk) 01-04-2006 31-12-2011
DD227K Naevus melanoc. extr. inferioris, gigant (Tierfell) 01-04-2006 31-12-2011
DD227L Naevus melanocyticus extremitatis inferioris, halo naevus 01-04-2006 31-12-2011
DD227M Naevus melanocyticus extremitatis inferioris, Ito naevus 01-04-2006 31-12-2011
DD227N Naevus melanocyticus extremitatis inferioris, Ota naevus 01-04-2006 31-12-2011
DD227P Naevus melanocyticus extremitatis inferioris, Spitz' naevus 01-04-2006 31-12-2011
DD227Q Naevus melanocyticus extremitatis inferioris, naevus spilus 01-04-2006 31-12-2011
DD227V Naevus melanoc. extr. inferioris, junctionalis (intraepid.) 01-04-2006 31-12-2011
DD227Z Naevus melanocyticus extremitatis inferioris, andet 01-04-2006 31-12-2011
DD228 Nævus med anden lokalisation 01-01-1994
DD228A Melanocytosis of Ito (Ito naevus) 01-04-2000 31-12-2011
DD228D Naevus melanocyticus med anden lokalisation, compositus 01-04-2006 31-12-2011
DD228E Naevus melanocyticus med anden lokalisation, congenitus 01-04-2006 31-12-2011
DD228F Naevus melanoc. med anden lokalisation, coeruleus (blue) 01-04-2006 31-12-2011
DD228G Naev melanoc. med anden lokalisation, dermalis (intraderm.) 01-04-2006 31-12-2011
DD228H Naev melanoc. med anden lokalisation, dysplastisk (atypisk) 01-04-2006 31-12-2011
DD228K Naevus melanoc. med anden lokalisation, gigant (Tierfell) 01-04-2006 31-12-2011
DD228L Naevus melanocyticus med anden lokalisation, halo naevus 01-04-2006 31-12-2011
DD228M Naevus melanocyticus med anden lokalisation, Ito naevus 01-04-2006 31-12-2011
DD228N Naevus melanocyticus med anden lokalisation, Ota naevus 01-04-2006 31-12-2011
DD228P Naevus melanocyticus med anden lokalisation, Spitz' naevus 01-04-2006 31-12-2011
DD228Q Naevus melanocyticus med anden lokalisation, naevus spilus 01-04-2006 31-12-2011
DD228V Naev melanoc. m an lok, junct (intraepid.) 01-04-2006 31-12-2011
DD228Z Naevus melanocyticus med anden lokalisation, andet 01-04-2006 31-12-2011
DD229 Nævus UNS 01-01-1994
DD229D Naevus melanocyticus uden specifikation , compositus 01-04-2006 31-12-2011
DD229E Naevus melanocyticus uden specifikation , congenitus 01-04-2006 31-12-2011
DD229F Naevus melanocyticus uden specifikation , coeruleus (blue) 01-04-2006 31-12-2011
DD229G Naevus melanoc. uden spec. , dermalis (intraderm.) 01-04-2006 31-12-2011
DD229H Naevus melanoc. uden spec. , dysplastisk (atypisk) 01-04-2006 31-12-2011
DD229K Naevus melanocyticus uden specifikation , gigant (Tierfell) 01-04-2006 31-12-2011
DD229L Naevus melanocyticus uden specifikation , halo naevus 01-04-2006 31-12-2011
DD229M Naevus melanocyticus uden specifikation , Ito naevus 01-04-2006 31-12-2011
DD229N Naevus melanocyticus uden specifikation , Ota naevus 01-04-2006 31-12-2011
DD229P Naevus melanocyticus uden specifikation, Spitz' naevus 01-04-2006 31-12-2011
DD229Q Nævus spilus 01-04-2006
DD229V Naevus melanoc. uden spec. , junctionalis (intraepid.) 01-04-2006 31-12-2011
DD229Z Naevus melanocyticus uden specifikation , andet 01-04-2006 31-12-2011
DD23 Andre godartede tumorer i huden 01-01-1994
DD230 Godartet tumor i hud på læbe 01-01-1994
DD230D Ne ben cut. labii, acrochordon (skin tag, fibroma molle) 01-04-2006 31-12-2011
DD230E Neoplasma benignum cutis labii, clear cell acanthoma 01-04-2006 31-12-2011
DD230F Neoplasma benignum cutis labii, cylindroma 01-04-2006 31-12-2011
DD230G Neoplasma benignum cutis labii, elastofibroma 01-04-2006 31-12-2011
DD230H Neoplasma benignum cutis labii, fibroma 01-04-2006 31-12-2011
DD230I Ne ben cut labii, pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD230J Neoplasma benignum cutis labii, dermatofibrom 01-04-2006 31-12-2011
DD230K Neoplasma benignum cutis labii, hidradenoma 01-04-2006 31-12-2011
DD230L Neoplasma benignum cutis labii, keratoakantom 01-04-2006 31-12-2011
DD230M Neoplasma benignum cutis labii, leiomyoma 01-04-2006 31-12-2011
DD230N Neoplasma benignum cutis labii, neurinoma 01-04-2006 31-12-2011
DD230Q Neoplasma benignum cutis labii, syringoma 01-04-2006 31-12-2011
DD230R Neoplasma benignum cutis labii, neurofibroma 01-04-2006 31-12-2011
DD230S Neopl. benign. cutis labii, fibrokeratoma, digital akkvisit 01-04-2006 31-12-2011
DD230T Neoplasma benignum cutis labii, trichoepithelioma 01-04-2006 31-12-2011
DD230U Neoplasma benignum cutis labii, poroma 01-04-2006 31-12-2011
DD230V Neoplasma benignum cutis labii, tricholemmoma 01-04-2006 31-12-2011
DD230X Neoplasma benignum cutis labii, sebaceøs tumor 01-04-2006 31-12-2011
DD230Y Neoplasma benignum cutis labii, angiofibroma 01-04-2006 31-12-2011
DD230Z Neoplasma benignum cutis labii, spiradenom, ekkrint 01-04-2006 31-12-2011
DD2301 Neoplasma benignum cutis labii, atypisk fibroxanthom 01-04-2006 31-12-2011
DD2302 Neoplasma benignum cutis labii, fibrous papule nose/face 01-04-2006 31-12-2011
DD2308 Neoplasma benignum cutis labii, andet 01-04-2006 31-12-2011
DD231 Godartet tumor i hud på øjenlåg 01-01-1994
DD231A Godartet tumor i hud i øjenkrog 01-01-1994
DD231B Neopl ben cutis palpebrae 01-01-1994 31-12-2011
DD231D Ne ben cut. palpebrae, acrochordon (skin tag, fibroma molle) 01-04-2006 31-12-2011
DD231E Neoplasma benignum cutis palpebrae, clear cell acanthoma 01-04-2006 31-12-2011
DD231F Neoplasma benignum cutis palpebrae, cylindroma 01-04-2006 31-12-2011
DD231G Neoplasma benignum cutis palpebrae, elastofibroma 01-04-2006 31-12-2011
DD231H Neoplasma benignum cutis palpebrae, fibroma 01-04-2006 31-12-2011
DD231I Ne ben cut palpebrae, pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD231J Neoplasma benignum cutis palpebrae, dermatofibrom 01-04-2006 31-12-2011
DD231K Neoplasma benignum cutis palpebrae, hidradenoma 01-04-2006 31-12-2011
DD231L Neoplasma benignum cutis palpebrae, keratoakantom 01-04-2006 31-12-2011
DD231M Neoplasma benignum cutis palpebrae, leiomyoma 01-04-2006 31-12-2011
DD231N Neoplasma benignum cutis palpebrae, neurinoma 01-04-2006 31-12-2011
DD231Q Neoplasma benignum cutis palpebrae, syringoma 01-04-2006 31-12-2011
DD231R Neoplasma benignum cutis palpebrae, neurofibroma 01-04-2006 31-12-2011
DD231S Ne ben cut. palpebrae, fibrokeratoma, digital akkvisit 01-04-2006 31-12-2011
DD231T Neoplasma benignum cutis palpebrae, trichoepithelioma 01-04-2006 31-12-2011
DD231U Neoplasma benignum cutis palpebrae, poroma 01-04-2006 31-12-2011
DD231V Neoplasma benignum cutis palpebrae, tricholemmoma 01-04-2006 31-12-2011
DD231X Neoplasma benignum cutis palpebrae, sebaceøs tumor 01-04-2006 31-12-2011
DD231Y Neoplasma benignum cutis palpebrae, angiofibroma 01-04-2006 31-12-2011
DD231Z Neoplasma benignum cutis palpebrae, spiradenom, ekkrint 01-04-2006 31-12-2011
DD2311 Neoplasma benignum cutis palpebrae, atypisk fibroxanthom 01-04-2006 31-12-2011
DD2312 Neoplasma benignum cutis palpebrae, fibrous papule nose/face 01-04-2006 31-12-2011
DD2318 Neoplasma benignum cutis palpebrae, andet 01-04-2006 31-12-2011
DD232 Godartet tumor i hud på øre eller i ydre øregang 01-01-1994
DD232A Godartet tumor i hud på øre 01-01-1994
DD232B Godartet tumor i hud i ydre øregang 01-01-1994
DD232D Ne ben cut aur et can aur ext., acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD232E Ne ben cut. aur et can auris ext., clear cell acanthoma 01-04-2006 31-12-2011
DD232F Neopl. benign. cut. auris et canalis auris ext., cylindroma 01-04-2006 31-12-2011
DD232G Ne ben cut. aur et can auris ext., elastofibr. 01-04-2006 31-12-2011
DD232H Neopl. benign. cutis auris et canalis auris ext., fibroma 01-04-2006 31-12-2011
DD232I Ne ben cut aur et can aur ext., pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD232J Ne ben cut. aur et can auris ext., dermatofibr. 01-04-2006 31-12-2011
DD232K Neopl. benign. cut. auris et canalis auris ext., hidrad. 01-04-2006 31-12-2011
DD232L Neopl. benign. cut. auris et canalis auris ext., keratoak. 01-04-2006 31-12-2011
DD232M Neopl. benign. cutis auris et canalis auris ext., leiomyoma 01-04-2006 31-12-2011
DD232N Neopl. benign. cutis auris et canalis auris ext., neurinoma 01-04-2006 31-12-2011
DD232Q Neopl. benign. cutis auris et canalis auris ext., syringoma 01-04-2006 31-12-2011
DD232R Neopl. benign. cut. auris et canalis auris ext., neurofib. 01-04-2006 31-12-2011
DD232S Ne ben cut aur et can aur ext., fibrokera, dig akk 01-04-2006 31-12-2011
DD232T Neopl. benign. cut. auris et canalis auris ext., trichoep. 01-04-2006 31-12-2011
DD232U Neopl. benign. cutis auris et canalis auris ext., poroma 01-04-2006 31-12-2011
DD232V Neopl. benign. cut. auris et canalis auris ext., trichol. 01-04-2006 31-12-2011
DD232X Ne ben cut. aur et can auris ext., sebaceøs tumor 01-04-2006 31-12-2011
DD232Y Neopl. benign. cut. auris et canalis auris ext., angiofib. 01-04-2006 31-12-2011
DD232Z Ne ben cut. aur et can auris ext., spiradenom, ekkrint 01-04-2006 31-12-2011
DD2321 Ne ben cut. aur et can auris ext., atypisk fibroxan. 01-04-2006 31-12-2011
DD2322 Ne ben cut. aur et can auris ext., fibrous papule nose/face 01-04-2006 31-12-2011
DD2328 Neoplasma benignum cutis auris et canalis auris ext., andet 01-04-2006 31-12-2011
DD233 Godartet tumor i hud i ansigtet m an/ikke spec. lokalisation 01-01-1994
DD233D Ne ben cut fac alia m an el i sp lok acroch (sk tag, fi mol) 01-04-2006 31-12-2011
DD233E Ne ben cut fac alia m an el i sp lok. , clear cell acant 01-04-2006 31-12-2011
DD233F Ne ben cut. fac alia med anden el i spec. lok. , cylindroma 01-04-2006 31-12-2011
DD233G Ne ben cut. fac alia med anden el i spec. lok. , elastofibr. 01-04-2006 31-12-2011
DD233H Ne ben cut. fac alia med anden el i spec. lok. , fibroma 01-04-2006 31-12-2011
DD233I Ne ben cut fac alia m an el i sp lok. , pilom (ep calc mal) 01-04-2006 31-12-2011
DD233J Ne ben cut fac alia m an el i sp lok. , dermatofibr. 01-04-2006 31-12-2011
DD233K Ne ben cut. fac alia med anden el i spec. lok. , hidrad. 01-04-2006 31-12-2011
DD233L Ne ben cut. fac alia med anden el i spec. lok. , keratoak. 01-04-2006 31-12-2011
DD233M Ne ben cut. fac alia med anden el i spec. lok. , leiomyoma 01-04-2006 31-12-2011
DD233N Ne ben cut. fac alia med anden el i spec. lok. , neurinoma 01-04-2006 31-12-2011
DD233Q Ne ben cut. fac alia med anden el i spec. lok. , syringoma 01-04-2006 31-12-2011
DD233R Ne ben cut. fac alia med anden el i spec. lok. , neurofib. 01-04-2006 31-12-2011
DD233S Ne ben cut fac alia m an el i sp lok. , fibrokera, dig akk 01-04-2006 31-12-2011
DD233T Ne ben cut. fac alia med anden el i spec. lok. , trichoep. 01-04-2006 31-12-2011
DD233U Ne ben cut. fac alia med anden el i spec. lok. , poroma 01-04-2006 31-12-2011
DD233V Ne ben cut. fac alia med anden el i spec. lok. , trichol. 01-04-2006 31-12-2011
DD233X Ne ben cut fac alia m an el i sp lok. , sebaceøs tumor 01-04-2006 31-12-2011
DD233Y Ne ben cut. fac alia med anden el i spec. lok. , angiofib. 01-04-2006 31-12-2011
DD233Z Ne ben cut fac alia m an el i sp lok. , spirad, ekkrint 01-04-2006 31-12-2011
DD2331 Ne ben cut fac alia m an el i sp lok. , atypisk fibroxan. 01-04-2006 31-12-2011
DD2332 Ne ben cut fac alia m an el i sp lok. , fib pap nose/face 01-04-2006 31-12-2011
DD2338 Ne ben cut. fac alia med anden el i spec. lok. , an 01-04-2006 31-12-2011
DD234 Godartet tumor i hud på skalpen eller halsen 01-01-1994
DD234A Godartet tumor i hud på skalpen 01-01-1994
DD234B Godartet tumor i hud på halsen 01-01-1994
DD234D Ne ben cut capillitii et colli, acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD234E Ne ben cut. capillitii et colli, clear cell acanthoma 01-04-2006 31-12-2011
DD234F Neoplasma benignum cutis capillitii et colli, cylindroma 01-04-2006 31-12-2011
DD234G Neoplasma benignum cutis capillitii et colli, elastofibroma 01-04-2006 31-12-2011
DD234H Neoplasma benignum cutis capillitii et colli, fibroma 01-04-2006 31-12-2011
DD234I Ne ben cut capillitii et colli, pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD234J Neoplasma benignum cutis capillitii et colli, dermatofibrom 01-04-2006 31-12-2011
DD234K Neoplasma benignum cutis capillitii et colli, hidradenoma 01-04-2006 31-12-2011
DD234L Neoplasma benignum cutis capillitii et colli, keratoakantom 01-04-2006 31-12-2011
DD234M Neoplasma benignum cutis capillitii et colli, leiomyoma 01-04-2006 31-12-2011
DD234N Neoplasma benignum cutis capillitii et colli, neurinoma 01-04-2006 31-12-2011
DD234Q Neoplasma benignum cutis capillitii et colli, syringoma 01-04-2006 31-12-2011
DD234R Neoplasma benignum cutis capillitii et colli, neurofibroma 01-04-2006 31-12-2011
DD234S Ne ben cut capillitii et colli, fibrokera, dig akk 01-04-2006 31-12-2011
DD234T Neopl. benign. cutis capillitii et colli, trichoepithelioma 01-04-2006 31-12-2011
DD234U Neoplasma benignum cutis capillitii et colli, poroma 01-04-2006 31-12-2011
DD234V Neoplasma benignum cutis capillitii et colli, tricholemmoma 01-04-2006 31-12-2011
DD234X Neoplasma benignum cutis capillitii et colli, sebaceøs tumor 01-04-2006 31-12-2011
DD234Y Neoplasma benignum cutis capillitii et colli, angiofibroma 01-04-2006 31-12-2011
DD234Z Neopl. benign. cut. capillitii et colli, spiradenom, ekkrint 01-04-2006 31-12-2011
DD2341 Neopl. benign. cut. capillitii et colli, atypisk fibroxan. 01-04-2006 31-12-2011
DD2342 Ne ben cut. capillitii et colli, fibrous papule nose/face 01-04-2006 31-12-2011
DD2348 Neoplasma benignum cutis capillitii et colli, andet 01-04-2006 31-12-2011
DD235 Godartet tumor i hud på kroppen 01-01-1994
DD235A Godartet tumor i hud i anus 01-01-1994
DD235B Godartet tumor i hud på mamma 01-01-1994
DD235C Perianal godartet tumor i huden 01-01-1994
DD235D Ne ben cut. trunci, acrochordon (skin tag, fibroma molle) 01-04-2006 31-12-2011
DD235E Neoplasma benignum cutis trunci, clear cell acanthoma 01-04-2006 31-12-2011
DD235F Neoplasma benignum cutis trunci, cylindroma 01-04-2006 31-12-2011
DD235G Neoplasma benignum cutis trunci, elastofibroma 01-04-2006 31-12-2011
DD235H Neoplasma benignum cutis trunci, fibroma 01-04-2006 31-12-2011
DD235I Ne ben cut trunci, pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD235J Neoplasma benignum cutis trunci, dermatofibrom 01-04-2006 31-12-2011
DD235K Neoplasma benignum cutis trunci, hidradenoma 01-04-2006 31-12-2011
DD235L Neoplasma benignum cutis trunci, keratoakantom 01-04-2006 31-12-2011
DD235M Neoplasma benignum cutis trunci, leiomyoma 01-04-2006 31-12-2011
DD235N Neoplasma benignum cutis trunci, neurinoma 01-04-2006 31-12-2011
DD235Q Neoplasma benignum cutis trunci, syringoma 01-04-2006 31-12-2011
DD235R Neoplasma benignum cutis trunci, neurofibroma 01-04-2006 31-12-2011
DD235S Neopl. benign. cutis trunci, fibrokeratoma, digital akkvisit 01-04-2006 31-12-2011
DD235T Neoplasma benignum cutis trunci, trichoepithelioma 01-04-2006 31-12-2011
DD235U Neoplasma benignum cutis trunci, poroma 01-04-2006 31-12-2011
DD235V Neoplasma benignum cutis trunci, tricholemmoma 01-04-2006 31-12-2011
DD235X Neoplasma benignum cutis trunci, sebaceøs tumor 01-04-2006 31-12-2011
DD235Y Neoplasma benignum cutis trunci, angiofibroma 01-04-2006 31-12-2011
DD235Z Neoplasma benignum cutis trunci, spiradenom, ekkrint 01-04-2006 31-12-2011
DD2351 Neoplasma benignum cutis trunci, atypisk fibroxanthom 01-04-2006 31-12-2011
DD2352 Neoplasma benignum cutis trunci, fibrous papule nose/face 01-04-2006 31-12-2011
DD2358 Neoplasma benignum cutis trunci, andet 01-04-2006 31-12-2011
DD236 Godartet tumor i hud på overekstremitet 01-01-1994
DD236A Godartet tumor i hud på skulder 01-01-1994
DD236B Neopl ben cutis extremitatis superioris 01-01-1994 31-12-2011
DD236D Ne ben cut extrem. Sup. , acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD236E Neoplasma benignum cutis extrem. Sup. , clear cell acanthoma 01-04-2006 31-12-2011
DD236F Neoplasma benignum cutis extrem. Sup. , cylindroma 01-04-2006 31-12-2011
DD236G Neoplasma benignum cutis extrem. Sup. , elastofibroma 01-04-2006 31-12-2011
DD236H Neoplasma benignum cutis extrem. Sup. , fibroma 01-04-2006 31-12-2011
DD236I Ne ben cut extrem. Sup. , pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD236J Neoplasma benignum cutis extrem. Sup. , dermatofibrom 01-04-2006 31-12-2011
DD236K Neoplasma benignum cutis extrem. Sup. , hidradenoma 01-04-2006 31-12-2011
DD236L Neoplasma benignum cutis extrem. Sup. , keratoakantom 01-04-2006 31-12-2011
DD236M Neoplasma benignum cutis extrem. Sup. , leiomyoma 01-04-2006 31-12-2011
DD236N Neoplasma benignum cutis extrem. Sup. , neurinoma 01-04-2006 31-12-2011
DD236Q Neoplasma benignum cutis extrem. Sup. , syringoma 01-04-2006 31-12-2011
DD236R Neoplasma benignum cutis extrem. Sup. , neurofibroma 01-04-2006 31-12-2011
DD236S Ne ben cut. extrem. Sup. , fibrokeratoma, digital akkvisit 01-04-2006 31-12-2011
DD236T Neoplasma benignum cutis extrem. Sup. , trichoepithelioma 01-04-2006 31-12-2011
DD236U Neoplasma benignum cutis extrem. Sup. , poroma 01-04-2006 31-12-2011
DD236V Neoplasma benignum cutis extrem. Sup. , tricholemmoma 01-04-2006 31-12-2011
DD236X Neoplasma benignum cutis extrem. Sup. , sebaceøs tumor 01-04-2006 31-12-2011
DD236Y Neoplasma benignum cutis extrem. Sup. , angiofibroma 01-04-2006 31-12-2011
DD236Z Neoplasma benignum cutis extrem. Sup. , spiradenom, ekkrint 01-04-2006 31-12-2011
DD2361 Neoplasma benignum cutis extrem. Sup. , atypisk fibroxanthom 01-04-2006 31-12-2011
DD2362 Neopl. benign. cutis extrem. Sup. , fibrous papule nose/face 01-04-2006 31-12-2011
DD2368 Neoplasma benignum cutis extrem. Sup. , andet 01-04-2006 31-12-2011
DD237 Godartet tumor i hud på underekstremitet 01-01-1994
DD237A Godartet tumor i hud på hofte 01-01-1994
DD237B Neopl ben cutis extremitatis inferioris 01-01-1994 31-12-2011
DD237D Ne ben cut extrem. Inf., acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD237E Neoplasma benignum cutis extrem. Inf., clear cell acanthoma 01-04-2006 31-12-2011
DD237F Neoplasma benignum cutis extrem. Inf., cylindroma 01-04-2006 31-12-2011
DD237G Neoplasma benignum cutis extrem. Inf., elastofibroma 01-04-2006 31-12-2011
DD237H Neoplasma benignum cutis extrem. Inf., fibroma 01-04-2006 31-12-2011
DD237I Ne ben cut extrem. Inf., pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD237J Neoplasma benignum cutis extrem. Inf., dermatofibrom 01-04-2006 31-12-2011
DD237K Neoplasma benignum cutis extrem. Inf., hidradenoma 01-04-2006 31-12-2011
DD237L Neoplasma benignum cutis extrem. Inf., keratoakantom 01-04-2006 31-12-2011
DD237M Neoplasma benignum cutis extrem. Inf., leiomyoma 01-04-2006 31-12-2011
DD237N Neoplasma benignum cutis extrem. Inf., neurinoma 01-04-2006 31-12-2011
DD237Q Neoplasma benignum cutis extrem. Inf., syringoma 01-04-2006 31-12-2011
DD237R Neoplasma benignum cutis extrem. Inf., neurofibroma 01-04-2006 31-12-2011
DD237S Ne ben cut. extrem. Inf., fibrokeratoma, digital akkvisit 01-04-2006 31-12-2011
DD237T Neoplasma benignum cutis extrem. Inf., trichoepithelioma 01-04-2006 31-12-2011
DD237U Neoplasma benignum cutis extrem. Inf., poroma 01-04-2006 31-12-2011
DD237V Neoplasma benignum cutis extrem. Inf., tricholemmoma 01-04-2006 31-12-2011
DD237X Neoplasma benignum cutis extrem. Inf., sebaceøs tumor 01-04-2006 31-12-2011
DD237Y Neoplasma benignum cutis extrem. Inf., angiofibroma 01-04-2006 31-12-2011
DD237Z Neoplasma benignum cutis extrem. Inf., spiradenom, ekkrint 01-04-2006 31-12-2011
DD2371 Neoplasma benignum cutis extrem. Inf., atypisk fibroxanthom 01-04-2006 31-12-2011
DD2372 Neopl. benign. cutis extrem. Inf., fibrous papule nose/face 01-04-2006 31-12-2011
DD2378 Neoplasma benignum cutis extrem. Inf., andet 01-04-2006 31-12-2011
DD238 Neopl ben cutis m anden lokalisation 01-01-1994 31-12-2011
DD238D Ne ben cut m an lok, acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD238E Ne ben cut. med anden lokalisation, clear cell acanthoma 01-04-2006 31-12-2011
DD238F Neoplasma benignum cutis med anden lokalisation, cylindroma 01-04-2006 31-12-2011
DD238G Neopl. benign. cutis med anden lokalisation, elastofibr. 01-04-2006 31-12-2011
DD238H Neoplasma benignum cutis med anden lokalisation, fibroma 01-04-2006 31-12-2011
DD238I Ne ben cut m an lok, pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD238J Neopl. benign. cutis med anden lokalisation, dermatofibr. 01-04-2006 31-12-2011
DD238K Neoplasma benignum cutis med anden lokalisation, hidradenoma 01-04-2006 31-12-2011
DD238L Neopl. benign. cutis med anden lokalisation, keratoakantom 01-04-2006 31-12-2011
DD238M Neoplasma benignum cutis med anden lokalisation, leiomyoma 01-04-2006 31-12-2011
DD238N Neoplasma benignum cutis med anden lokalisation, neurinoma 01-04-2006 31-12-2011
DD238Q Neoplasma benignum cutis med anden lokalisation, syringoma 01-04-2006 31-12-2011
DD238R Neopl. benign. cutis med anden lokalisation, neurofibroma 01-04-2006 31-12-2011
DD238S Ne ben cut m an lok, fibrokera, dig akk 01-04-2006 31-12-2011
DD238T Neopl. benign. cut. med anden lokalisation, trichoep. 01-04-2006 31-12-2011
DD238U Neoplasma benignum cutis med anden lokalisation, poroma 01-04-2006 31-12-2011
DD238V Neopl. benign. cutis med anden lokalisation, tricholemmoma 01-04-2006 31-12-2011
DD238X Neopl. benign. cutis med anden lokalisation, sebaceøs tumor 01-04-2006 31-12-2011
DD238Y Neopl. benign. cutis med anden lokalisation, angiofibroma 01-04-2006 31-12-2011
DD238Z Ne ben cut. med anden lokalisation, spiradenom, ekkrint 01-04-2006 31-12-2011
DD2381 Ne ben cut. med anden lokalisation, atypisk fibroxan. 01-04-2006 31-12-2011
DD2382 Ne ben cut. med anden lokalisation, fibrous papule nose/face 01-04-2006 31-12-2011
DD2388 Neoplasma benignum cutis med anden lokalisation, andet 01-04-2006 31-12-2011
DD239 Godartet tumor i huden UNS 01-01-1994
DD239A Akrokordon 01-07-2005 31-12-2011
DD239D Ne ben cut u specifikation, acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD239E Neopl. benign. cut. uden specifikation, clear cell acanthoma 01-04-2006 31-12-2011
DD239F Neoplasma benignum cutis uden specifikation, cylindroma 01-04-2006 31-12-2011
DD239G Neoplasma benignum cutis uden specifikation, elastofibroma 01-04-2006 31-12-2011
DD239H Neoplasma benignum cutis uden specifikation, fibroma 01-04-2006 31-12-2011
DD239I Ne ben cut u specifikation, pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD239J Neoplasma benignum cutis uden specifikation, dermatofibrom 01-04-2006 31-12-2011
DD239K Neoplasma benignum cutis uden specifikation, hidradenoma 01-04-2006 31-12-2011
DD239L Neoplasma benignum cutis uden specifikation, keratoakantom 01-04-2006 31-12-2011
DD239M Neoplasma benignum cutis uden specifikation, leiomyoma 01-04-2006 31-12-2011
DD239N Neoplasma benignum cutis uden specifikation, neurinoma 01-04-2006 31-12-2011
DD239Q Neoplasma benignum cutis uden specifikation, syringoma 01-04-2006 31-12-2011
DD239R Neoplasma benignum cutis uden specifikation, neurofibroma 01-04-2006 31-12-2011
DD239S Ne ben cut. u specifikation, fibrokeratoma, digital akkvisit 01-04-2006 31-12-2011
DD239T Neopl. benign. cutis uden specifikation, trichoepithelioma 01-04-2006 31-12-2011
DD239U Neoplasma benignum cutis uden specifikation, poroma 01-04-2006 31-12-2011
DD239V Neoplasma benignum cutis uden specifikation, tricholemmoma 01-04-2006 31-12-2011
DD239X Neoplasma benignum cutis uden specifikation, sebaceøs tumor 01-04-2006 31-12-2011
DD239Y Neoplasma benignum cutis uden specifikation, angiofibroma 01-04-2006 31-12-2011
DD239Z Neopl. benign. cutis uden specifikation, spiradenom, ekkrint 01-04-2006 31-12-2011
DD2391 Neopl. benign. cut. uden specifikation, atypisk fibroxan. 01-04-2006 31-12-2011
DD2392 Ne ben cut. u specifikation, fibrous papule nose/face 01-04-2006 31-12-2011
DD2398 Neoplasma benignum cutis uden specifikation, andet 01-04-2006 31-12-2011
DD24 Godartede tumorer i mamma 01-01-1994
DD249 Godartet tumor i mamma UNS 01-01-1994
DD249A Fibroadenom i mamma 01-01-1994
DD249B Lipoma mammae 01-01-1994 31-12-2011
DD249C Papilloma ductuli mammae 01-01-1994
DD249D Adenom i brystvorte 01-07-2004
DD249E Benign phylloides tumor i bryst 01-07-2004
DD249F Harmartom i mamma 01-07-2004
DD249G Fibromatose i mamma 01-07-2004
DD249W Anden godartet tumor i mamma 01-07-2004
DD25 Fibromyom i livmoderen 01-01-1994
DD250 Submukøst fibromyom i livmoderen 01-01-1994
DD250A Submukøst fibromyom type 0 i livmoderen 01-04-2006
DD250B Submukøst fibromyom type 1 i livmoderen 01-04-2006
DD250C Submukøst fibromyom type 2 i livmoderen 01-04-2006
DD251 Intramuralt fibromyom i livmoderen 01-01-1994
DD252 Subserøst fibromyom i livmoderen 01-01-1994
DD259 Fibromyom i livmoderen UNS 01-01-1994
DD26 Andre godartede tumorer i livmoderen 01-01-1994
DD260 Godartet tumor i livmoderhalsen 01-01-1994
DD261 Godartet tumor i corpus uteri 01-01-1994
DD267 Godartet tumor i livmoderen med anden lokalisation 01-01-1994
DD269 Godartet tumor i livmoderen UNS 01-01-1994
DD27 Godartede tumorer i æggestok 01-01-1994
DD270 Serøst cystadenom i æggestok 01-01-1994
DD271 Mucinøst cystadenom i æggestok 01-01-1994
DD272 Dermoidcyste i æggestok 01-01-1994
DD278 Anden form for godartet tumor i æggestok 01-01-1994
DD279 Godartet tumor i æggestok UNS 01-01-1994
DD28 Godartet tumor i an/ikke spec. kvind. kønsorganer 01-01-1994
DD280 Godartet tumor i vulva 01-01-1994
DD281 Godartet tumor i vagina 01-01-1994
DD282 Godartet tumor i æggeleder eller livmoderens ligamenter 01-01-1994
DD282A Godartet tumor i ligamentum lati 01-01-1994
DD282B Godartet tumor i ligamentum rotundi 01-01-1994
DD282C Godartet tumor i æggeleder 01-01-1994
DD287 Godartet tumor i andet kvindeligt kønsorgan 01-01-1994
DD289 Godartet tumor i kvindeligt kønsorgan UNS 01-01-1994
DD289D Ne ben genit. fem non spec., acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD289E Ne ben genit. fem non spec., clear cell acanthoma 01-04-2006 31-12-2011
DD289F Neoplasma benignum genitalium feminae non spec., cylindroma 01-04-2006 31-12-2011
DD289G Neopl. benign. genitalium feminae non spec., elastofibr. 01-04-2006 31-12-2011
DD289H Neoplasma benignum genitalium feminae non spec., fibroma 01-04-2006 31-12-2011
DD289I Ne ben genit. fem non spec., pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD289J Neopl. benign. genitalium feminae non spec., dermatofibr. 01-04-2006 31-12-2011
DD289K Neoplasma benignum genitalium feminae non spec., hidradenoma 01-04-2006 31-12-2011
DD289L Neopl. benign. genitalium feminae non spec., keratoakantom 01-04-2006 31-12-2011
DD289M Neoplasma benignum genitalium feminae non spec., leiomyoma 01-04-2006 31-12-2011
DD289N Neoplasma benignum genitalium feminae non spec., neurinoma 01-04-2006 31-12-2011
DD289Q Neoplasma benignum genitalium feminae non spec., syringoma 01-04-2006 31-12-2011
DD289R Neopl. benign. genitalium feminae non spec., neurofibroma 01-04-2006 31-12-2011
DD289S Ne ben genit. fem non spec., fibrokeratoma, digital akkvisit 01-04-2006 31-12-2011
DD289T Neopl. benign. genit. feminae non spec., trichoep. 01-04-2006 31-12-2011
DD289U Neoplasma benignum genitalium feminae non spec., poroma 01-04-2006 31-12-2011
DD289V Neopl. benign. genitalium feminae non spec., tricholemmoma 01-04-2006 31-12-2011
DD289X Neopl. benign. genitalium feminae non spec., sebaceøs tumor 01-04-2006 31-12-2011
DD289Y Neopl. benign. genitalium feminae non spec., angiofibroma 01-04-2006 31-12-2011
DD289Z Neopl. benign. genit. feminae non spec., spiradenom, ekkrint 01-04-2006 31-12-2011
DD2891 Neopl. benign. genit. feminae non spec., atypisk fibroxan. 01-04-2006 31-12-2011
DD2892 Ne ben genit. fem non spec., fibrous papule nose/face 01-04-2006 31-12-2011
DD2898 Neoplasma benignum genitalium feminae non spec., andet 01-04-2006 31-12-2011
DD29 Godartede tumorer i mandlige kønsorganer 01-01-1994
DD290 Godartet tumor i penis 01-01-1994
DD291 Godartet tumor i prostata 01-01-1994
DD292 Godartet tumor i testikel 01-01-1994
DD293 Godartet tumor i epididymis 01-01-1994
DD294 Godartet tumor i scrotum 01-01-1994
DD297 Godartet tumor i mandlige kønsorganer med anden lokalisation 01-01-1994
DD297A Godartet tumor i sædstreng 01-01-1994
DD297B Godartet tumor i tunica vaginalis 01-01-1994
DD297C Godartet tumor i vesicula seminalis 01-01-1994
DD299 Godartet tumor i mandligt kønsorgan UNS 01-01-1994
DD299D Ne ben genit. viri non spec., acroch (skin tag, fi mol) 01-04-2006 31-12-2011
DD299E Neopl. benign. genit. viri non spec., clear cell acanthoma 01-04-2006 31-12-2011
DD299F Neoplasma benignum genitalium viri non spec., cylindroma 01-04-2006 31-12-2011
DD299G Neoplasma benignum genitalium viri non spec., elastofibroma 01-04-2006 31-12-2011
DD299H Neoplasma benignum genitalium viri non spec., fibroma 01-04-2006 31-12-2011
DD299I Ne ben genit. viri non spec., pilomatr. (ep calc mal) 01-04-2006 31-12-2011
DD299J Neoplasma benignum genitalium viri non spec., dermatofibrom 01-04-2006 31-12-2011
DD299K Neoplasma benignum genitalium viri non spec., hidradenoma 01-04-2006 31-12-2011
DD299L Neoplasma benignum genitalium viri non spec., keratoakantom 01-04-2006 31-12-2011
DD299M Neoplasma benignum genitalium viri non spec., leiomyoma 01-04-2006 31-12-2011
DD299N Neoplasma benignum genitalium viri non spec., neurinoma 01-04-2006 31-12-2011
DD299Q Neoplasma benignum genitalium viri non spec., syringoma 01-04-2006 31-12-2011
DD299R Neoplasma benignum genitalium viri non spec., neurofibroma 01-04-2006 31-12-2011
DD299S Ne ben genit. viri non spec., fibrokera, dig akk 01-04-2006 31-12-2011
DD299T Neopl. benign. genitalium viri non spec., trichoepithelioma 01-04-2006 31-12-2011
DD299U Neoplasma benignum genitalium viri non spec., poroma 01-04-2006 31-12-2011
DD299V Neoplasma benignum genitalium viri non spec., tricholemmoma 01-04-2006 31-12-2011
DD299X Neoplasma benignum genitalium viri non spec., sebaceøs tumor 01-04-2006 31-12-2011
DD299Y Neoplasma benignum genitalium viri non spec., angiofibroma 01-04-2006 31-12-2011
DD299Z Neopl. benign. genit. viri non spec., spiradenom, ekkrint 01-04-2006 31-12-2011
DD2991 Neopl. benign. genit. viri non spec., atypisk fibroxan. 01-04-2006 31-12-2011
DD2992 Ne ben genit. viri non spec., fibrous papule nose/face 01-04-2006 31-12-2011
DD2998 Neoplasma benignum genitalium viri non spec., andet 01-04-2006 31-12-2011
DD30 Godartede tumorer i nyrer og urinveje 01-01-1994
DD300 Godartet tumor i nyre 01-01-1994
DD301 Godartet tumor i nyrebækken 01-01-1994
DD302 Godartet tumor i urinleder 01-01-1994
DD303 Godartet tumor i urinblæren 01-01-1994
DD304 Godartet tumor i urinrøret 01-01-1994
DD307 Godartet tumor i urinveje med anden lokalisation 01-01-1994
DD309 Godartet tumor i nyre eller urinveje UNS 01-01-1994
DD31 Godartede tumorer i øje og omgivende strukturer 01-01-1994
DD310 Godartet tumor i konjunktiva 01-01-1994
DD311 Godartet tumor i hornhinde 01-01-1994
DD312 Godartet tumor i nethinde 01-01-1994
DD313 Godartet tumor i choroidea 01-01-1994
DD314 Godartet tumor i corpus ciliare 01-01-1994
DD315 Godartet tumor i tårekirtel eller tårekanal 01-01-1994
DD315A Godartet tumor i tårekanal 01-01-1994
DD315B Godartet tumor i tårekirtel 01-01-1994
DD315C Godartet tumor i tåresæk 01-01-2012
DD316 Godartet tumor i øjenhule 01-01-1994
DD316A Retrobulbær godartet tumor 01-01-1994
DD317 Neopl ben oculi et adnexae oculi m anden lokalisation 01-01-1994 31-12-2011
DD319 Godartet tumor i øje UNS 01-01-1994
DD32 Godartede tumorer i hjernehinder og rygmarvshinder 01-01-1994
DD320 Intrakranielt meningeom 01-01-1994
DD321 Intraspinalt meningeom 01-01-1994
DD329 Meningeom UNS 01-01-1994
DD329A Meningeoma 01-01-1994 31-12-2011
DD33 Godartede tumorer i hjernen og andre dele af CNS 01-01-1994
DD330 Supratentoriel godartet tumor i hjernen 01-01-1994
DD330A Godartet tumor i hjernens pandelap 01-01-1994
DD330B Godartet tumor i hjernens nakkelap 01-01-1994
DD330C Godartet tumor i hjernens isselap 01-01-1994
DD330D Godartet tumor i hjernens tindingelap 01-01-1994
DD331 Infratentoriel godartet tumor i hjernen 01-01-1994
DD331A Godartet tumor i lillehjernen 01-01-1994
DD331B Godartet tumor i hjernens 4. ventrikel 01-01-1994
DD331C Godartet tumor i hjernestammen 01-01-1994
DD331D Godartet tumor i hjernebroen 01-01-1994
DD332 Godartet tumor i hjernen UNS 01-01-1994
DD333 Godartet tumor i hjernenerve 01-01-1994
DD333A Godartet tumor i bulbus olfactorius 01-01-1994
DD333B Godartet tumor i hørenerve 01-01-1994
DD334 Godartet tumor i rygmarven 01-01-1994
DD337 Godartet tumor i anden del af centralnervesystemet 01-01-1994
DD339 Godartet tumor i centralnervesystemet UNS 01-01-1994
DD34 Godartede tumorer i skjoldbruskkirtlen 01-01-1994
DD349 Godartet tumor i skjoldbruskkirtlen UNS 01-01-1994
DD35 Godartet tumor i an/ikke spec. endokrine kirtler 01-01-1994
DD350 Godartet tumor i binyre 01-01-1994
DD350A Fæokromocytom 01-01-1994
DD351 Godartet tumor i biskjoldbruskkirtel 01-01-1994
DD352 Godartet tumor i hypofysen 01-01-1994
DD352A Adenom i hypofysen 01-01-1994
DD353 Godartet tumor i ductus craniopharyngeus 01-01-1994
DD354 Godartet tumor i corpus pineale 01-01-1994
DD355 Godartet tumor i glomus caroticum 01-01-1994
DD356 Godartet tumor i corpus para-aorticus el. andet paraganglion 01-01-1994
DD356A Godartet tumor i corpus para-aorticus 01-01-1994
DD356B Godartet tumor i paraganglion 01-01-1994
DD356C Godartet tumor i glomus jugulare 01-07-2004
DD357 Godartet tumor i anden endokrin kirtel 01-01-1994
DD358 Neoplasma benignum pluriglandulare 01-01-1994
DD359 Godartet tumor i endokrin kirtel UNS 01-01-1994
DD36 Godartede tumorer med anden eller ikke spec. lokalisation 01-01-1994
DD360 Godartet tumor i lymfeknude 01-01-1994
DD361 Godartet tumor i perifer nerve el. det autonome nervesystem 01-01-1994
DD361A Godartet tumor i perifer nerve 01-01-1994
DD361B Godartet tumor i det autonome nervesystem 01-01-1994
DD367 Godartet tumor med anden lokalisation 01-01-1994
DD367A Castleman sygdom 01-01-2018
DD369 Godartet tumor uden spec. lokalisation 01-01-1994
DD37 Tumorer i mundhule og fordøj-org. af usikker/ukendt karakter 01-01-1994
DD370 Ikke specificeret tumor i læbe, mundhule eller svælg 01-01-1994
DD370A Ikke spec. tumor i mundhulen 01-01-1994
DD370B Ikke spec. tumor i læbe 01-01-1994
DD370C Ikke spec. tumor i svælget 01-01-1994
DD371 Ikke spec. tumor i mavesækken 01-01-1994
DD372 Ikke spec. tumor i tyndtarmen 01-01-1994
DD373 Ikke spec. tumor i blindtarmen 01-01-1994
DD374 Ikke spec. tumor i tyktarmen 01-01-1994
DD375 Ikke spec. tumor i endetarmen 01-01-1994
DD375A Neopl rectosigmoidei uden specifikation 01-01-1994 30-09-2008
DD376 Ikke spec. tumor i leveren, galdeblæren eller galdeveje 01-01-1994
DD376A Ikke spec. tumor i leveren 01-01-1994
DD376B Ikke spec. tumor i galdeblæren 01-01-1994
DD376C Ikke spec. tumor i galdeveje 01-01-1994
DD377 Ikke spec. tumor i andet fordøjelsesorgan 01-01-1994
DD377A Ikke spec. tumor i anus 01-01-2012
DD377B Ikke spec. tumor i spiserøret 01-01-2012
DD377C Ikke specificeret tumor i pancreas 01-01-2012
DD379 Ikke spec. tumor i fordøjelsesorgan UNS 01-01-1994
DD38 Ikke spec. tumorer i mellemøre, åndedrætsorgan, brystorgan 01-01-1994
DD380 Ikke spec. tumor i strubehovedet 01-01-1994
DD381 Ikke specificeret tumor i luftrør, bronkie eller lunge 01-01-1994
DD381A Ikke spec. tumor i bronkie 01-01-1994
DD381B Ikke spec. tumor i lunge 01-01-1994
DD381C Ikke spec. tumor i luftrøret 01-01-1994
DD382 Ikke spec. tumor i lungehinde 01-01-1994
DD383 Ikke spec. tumor i mediastinum 01-01-1994
DD384 Ikke spec. tumor i thymus 01-01-1994
DD385 Ikke spec. tumor i andet åndedrætsorgan 01-01-1994
DD385A Ikke spec. tumor i mellemøre 01-01-1994
DD385B Ikke spec. tumor i næsebrusken 01-01-1994
DD385C Ikke spec. tumor i næsehulen 01-01-1994
DD385D Ikke spec. tumor i bihule 01-01-1994
DD389 Ikke specificeret tumor i åndedrætsorgan eller luftveje UNS 01-01-1994
DD39 Tumorer i kvind. kønsorganer af usikker og ukendt karakter 01-01-1994
DD390 Ikke spec. tumor i livmoderen 01-01-1994
DD391 Ikke spec. tumor i æggestok 01-01-1994
DD391A Ovarietumor af borderline type 01-01-2001
DD392 Ikke spec. tumor i placenta 01-01-1994
DD392A Chorioadenoma destruens 01-01-1994
DD392B Mola hydatidosa maligna 01-01-1994
DD397 Ikke spec. tumor med an. lokalisation i kvindeligt kønsorgan 01-01-1994
DD397A Ikke spec. hudtumor i kvindeligt kønsorgan 01-01-2012
DD399 Ikke spec. tumor i kvindeligt kønsorgan UNS 01-01-1994
DD40 Tumorer i mandlige kønsorganer af usikker og ukendt karakter 01-01-1994
DD400 Ikke spec. tumor i prostata 01-01-1994
DD401 Ikke spec. tumor i testikel 01-01-1994
DD407 Ikke spec. tumor med anden lokalisation i mandligt kønsorgan 01-01-1994
DD407A Ikke spec. hudtumor i mandligt kønsorgan 01-01-2012
DD409 Ikke spec. tumor i mandligt kønsorgan UNS 01-01-1994
DD41 Tumorer i nyre og urinveje af usikker og ukendt karakter 01-01-1994
DD410 Ikke spec. tumor i nyre 01-01-1994
DD411 Ikke spec. tumor i nyrebækken 01-01-1994
DD412 Ikke spec. tumor i urinleder 01-01-1994
DD413 Ikke spec. tumor i urinrøret 01-01-1994
DD414 Ikke spec. tumor i urinblæren 01-01-1994
DD417 Ikke specificeret tumor med anden lokalisation i urinveje 01-01-1994
DD419 Ikke spec. tumor med ikke spec. lokalisation i nyre/urinveje 01-01-1994
DD42 Ikke spec. tumorer i hjerne- og rygmarvshinder 01-01-1994
DD420 Ikke spec. tumor i hjernehinde 01-01-1994
DD421 Ikke spec. tumor i rygmarvshinde 01-01-1994
DD429 Ikke spec. tumor m ikke spec. lokal. i hjerne-/rygmarvshinde 01-01-1994
DD43 Ikke spec. tumorer i hjerne og hjernenerver 01-01-1994
DD430 Supratentoriel ikke spec. tumor i hjernen 01-01-1994
DD430B Ikke spec. tumor i hjernens frontallap 01-07-2003
DD430C Ikke spec. tumor i hjernens nakkelap 01-07-2003
DD430D Ikke spec. tumor i hjernens isselap 01-07-2003
DD430E Ikke spec. tumor i hjernens tindingelap 01-07-2003
DD430F Ikke spec. tumor i hjerneventrikel 01-07-2003
DD431 Infratentoriel ikke spec. tumor i hjernen 01-01-1994
DD431A FEJLOPRETTET 01-01-1994 01-01-2012
DD431B FEJLOPRETTET 01-01-1994 01-01-2012
DD431C FEJLOPRETTET 01-01-1994 01-01-2012
DD431D Neopl cerebri lobus parietalis uden specifikation 01-01-1994 30-06-2003
DD431E Neopl cerebri lobus temporalis uden specifikation 01-01-1994 01-07-2003
DD431F Neopl cerebri ventriculi uden specifikation 01-01-1994 01-07-2003
DD431G Ikke spec. tumor i hjernestammen 01-01-2012
DD431H Ikke spec. tumor i lillehjernen 01-01-2012
DD431J Ikke spec. tumor i hjernens 4. ventrikel 01-01-2012
DD432 Ikke spec. tumor med an./ikke nærmere spec. lokal. i hjerne 01-01-1994
DD433 Ikke spec. tumor i hjernenerve 01-01-1994
DD434 Ikke spec. tumor i rygmarven 01-01-1994
DD437 Ikke specificeret tumor med anden lokalisation i CNS 01-01-1994
DD439 Ikke spec. tumor i ikke spec. lokal. i CNS 01-01-1994
DD44 Tumorer i endokrine kirtler af usikker og ukendt karakter 01-01-1994
DD440 Ikke spec. tumor i skjoldbruskkirtlen 01-01-1994
DD441 Ikke spec. tumor i binyre 01-01-1994
DD442 Ikke spec. tumor i biskjoldbruskkirtel 01-01-1994
DD443 Ikke spec. tumor i hypofysen 01-01-1994
DD444 Ikke spec. tumor i ductus craniopharyngeus 01-01-1994
DD445 Ikke spec. tumor i corpus pinealis 01-01-1994
DD446 Ikke spec. tumor i glomus caroticum 01-01-1994
DD447 Ikke spec. tumor i corpus para-aorticus el. an. paraganglion 01-01-1994
DD447A Ikke spec. tumor i corpus para-aorticus 01-01-1994
DD447B Ikke spec. tumor i andet paraganglion 01-01-1994
DD448 Ikke spec. tumor i flere endokrine kirtler 01-01-1994
DD448A Multipel endokrin adenomatose 01-01-2012
DD449 Ikke spec. tumor i endokrin kirtel UNS 01-01-1994
DD45 Polycythaemia vera 01-01-1994
DD459 Polycythaemia vera 01-01-1994
DD46 Myelodysplastiske syndromer 01-01-1994
DD460 Refraktær cytopeni med unilineær dysplasi 01-01-1994
DD460A Refraktær anæmi uden sideroblaster 01-01-2012
DD460B Refraktær neutropeni 01-01-2012
DD460C Refraktær trombopeni 01-01-2012
DD461 Refraktær anæmi med ringsideroblaster 01-01-1994
DD462 Refraktær anæmi med overskud af blastceller 01-01-1994
DD462A Refraktær anæmi med overskud af blastceller, RAEB I 01-01-2012
DD462B Refraktær anæmi med overskud af blastceller, RAEB II 01-01-2012
DD463 Anaemia refractoria m blastceller i transformation 01-01-1994 31-12-2011
DD464 Refraktær anæmi UNS 01-01-1994
DD465 Refraktær anæmi med multilinje dysplasi 01-01-2012
DD466 Myelodysplastisk syndrom m isoleret del(5q) kromosomabnormit 01-01-2012
DD467 Andet myelodysplastisk syndrom 01-01-1994
DD469 Myelodysplastisk syndrom UNS 01-01-1994
DD47 Andre neoplasier fra lymfoidt og hæmatopoietisk væv 01-01-1994
DD470 Histiocytær el mastcelle neoplasi af usikker/ukendt karakter 01-01-1994
DD470A Mastcelle tumor UNS 01-04-2000
DD470B Indolent mastocytosis 01-01-2012
DD470C System.mastocytose, assoc.m klon.hæmatopo.non-mastcelle sygd 01-01-2012
DD471 Kronisk myeloproliferativt syndrom 01-01-1994
DD471A Myelosclerosis 01-01-1994 31-12-2011
DD471B Myeloproliferativ sygdom UNS 01-01-2012
DD472 Monoklonal gammopati med ubestemt signifikans (MGUS) 01-01-1994
DD472A MGUS af IgM type 01-07-2022
DD472B MGUS af non-IGM type 01-07-2022
DD473 Essentiel trombocytæmi 01-01-1994
DD474 Primær og sekundær myelofibrose 01-10-2003
DD474A Primær myelofibrose 01-01-2012
DD474B Sekundær myelofibrose efter polycytæmia vera 01-01-2012
DD474C Sekundær myelofibrose efter essentiel trombocytose 01-01-2012
DD475 Hypereosinofilt syndrom 01-01-2012
DD477 An. ikke spec. neoplasi fra lymfoidt el. hæmatopoietisk væv 01-01-1994
DD477A Lymfomatoid granulomatose 01-04-2000
DD477B Castleman's sygdom 01-01-2012 31-12-2017
DD477C Tidlig post-transplantations lymfoproliferativ sygd. 01-01-2012
DD477D Lymfomatoid papulose 01-04-2019
DD479 Anden neoplasi fra lymfoidt eller hæmatopoietisk væv 01-01-1994
DD479A Lymfoproliferativ sygdom UNS 01-01-2012
DD479B Monoklonal B-celle lymfocytose (MBL) 01-01-2016
DD48 Tumorer af usikker og ukendt karakt. m. an. og uspec. lokal. 01-01-1994
DD480 Ikke specificeret tumor i knogle eller ledbrusk 01-01-1994
DD481 Ikke specificeret tumor i bindevæv eller andre bløddele 01-01-1994
DD482 Ikke spec. tumor i perifer nerve eller autonome nervesystem 01-01-1994
DD482A Ikke spec. tumor i parasympatisk ganglion 01-01-1994
DD482B Ikke spec. tumor i perifert ganglion 01-01-1994
DD482C Ikke spec. tumor i sympatisk ganglion 01-01-1994
DD482D Ikke spec. tumor i autonome nervesystem 01-01-1994
DD482E Ikke spec. tumor i perifer nerve 01-01-1994
DD483 Ikke spec. tumor i retroperitoneum 01-01-1994
DD484 Ikke spec. tumor i peritoneum 01-01-1994
DD485 Ikke spec. tumor i huden 01-01-1994
DD485A Ikke spec. tumor i hud i anus 01-01-2012
DD485B Ikke spec. tumor i hud på mamma 01-01-2012
DD485C Ikke spec. tumor i hud i perineum 01-01-2012
DD485D Ikke spec. tumor i hud på øjenlåg 01-01-2012
DD486 Ikke spec. tumor i mamma 01-01-1994
DD486A Phylloides tumor i bryst af usikker eller ukendt karakter 01-01-2012
DD487 Ikke specificeret tumor med anden lokalisation 01-01-1994
DD487A Ikke spec. tumor i hjertet 01-01-1994
DD487B Ikke spec. tumor i perifer nerve i øjenhule 01-01-1994
DD487C Ikke spec. tumor i øje UNS 01-01-1994
DD487D Ikke spec. tumor i mediastinum UNS 01-07-2006
DD489 Tumor af usikker el. ukendt karakter u. nærmere spec. lokal. 01-01-1994
DD50 Jernmangelanæmi 01-01-1994
DD500 Kronisk blødningsanæmi 01-01-1994
DD501 Jernmangelanæmi forårsaget af malabsorption af jern 01-01-1994
DD501A Plummer-Vinson syndrom 01-01-1994
DD508 Jernmangelanæmi af anden årsag 01-01-1994
DD508A Jernmangelanæmi forårsaget af insufficient indtag af jern 01-01-2012
DD509 Jernmangelanæmi UNS 01-01-1994
DD509A Hypokrom anæmi UNS 01-01-1994
DD51 Anæmi forårsaget af vitamin B12-mangel 01-01-1994
DD510 Anæmi sfa vitamin B12-mangel ved mangel på intrinsic factor 01-01-1994
DD510A Anaemia perniciosa 01-01-1994 31-12-2011
DD511 Anæmi f.a. malabsorption af vitamin B12 med proteinuri 01-01-1994
DD511A Arvelig megaloblastær anæmi 01-01-1994
DD511B Syndroma Imerslund(-Gräsbeck) 01-01-1994 31-12-2011
DD512 Anæmi forårsaget af mangel på transkobalamin II 01-01-1994
DD513 Anden anæmi f.a. ernæringsbetinget mangel på vitamin B12 01-01-1994
DD513A Veganæmi 01-01-2012
DD518 Anden anæmi forårsaget af vitamin B12-mangel 01-01-1994
DD519 Anæmi forårsaget af vitamin B12-mangel UNS 01-01-1994
DD52 Anæmi forårsaget af folinsyremangel 01-01-1994
DD520 Anæmi forårsaget af ernæringsbetinget folinsyremangel 01-01-1994
DD521 Anæmi forårsaget af medikamentelt betinget folinsyremangel 01-01-1994
DD528 Anden anæmi forårsaget af folinsyremangel 01-01-1994
DD529 Anæmi forårsaget af folinsyremangel UNS 01-01-1994
DD53 Andre ernæringsbetingede anæmier 01-01-1994
DD530 Proteinmangelanæmi 01-01-1994
DD531 Anden megaloblastær anæmi IKA 01-01-1994
DD531A Megaloblastær anæmi UNS 01-01-1994
DD532 Anæmi forårsaget af vitamin C-mangel 01-01-1994
DD538 Anden ernæringsbetinget anæmi 01-01-1994
DD538A Anæmi forårsaget af kobbermangel 01-01-1994
DD538B Anæmi forårsaget af molybdænmangel 01-01-1994
DD538C Anæmi forårsaget af zinkmangel 01-01-1994
DD538M Anæmi v. malabsorption efter tidligere kirurgisk indgreb UNS 01-01-2012
DD539 Ernæringsbetinget anæmi UNS 01-01-1994
DD55 Anæmi forårsaget af enzymatiske forstyrrelser 01-01-1994
DD550 Anæmi forårsaget af glukose-6-fosfat-dehydrogenasemangel 01-01-1994
DD551 Anæmi forårsaget af an. forstyrrelse i glutationomsætningen 01-01-1994
DD552 Anæmi forårsaget af forstyrrelser i de glykolytiske enzymer 01-01-1994
DD553 Anæmi forårsaget af forstyrrelser i nukleotidomsætningen 01-01-1994
DD558 Anden anæmi forårsaget af enzymatisk forstyrrelse 01-01-1994
DD559 Anæmi forårsaget af enzymatisk forstyrrelse UNS 01-01-1994
DD56 Talassæmier 01-01-1994
DD560 Alfa-talassæmi 01-01-1994
DD561 Beta-talassæmi 01-01-1994
DD561A Thalassaemia major 01-01-1994
DD561B Thalassaemia major 01-01-1994 31-12-2011
DD561C Thalassaemia intermedia 01-01-2012
DD562 Delta-beta talassæmi 01-01-2012
DD563 Thalassaemia minor 01-01-1994
DD563C Thalassaemia intermedia 01-01-1994 31-12-2011
DD564 Arveligt persisterende føtalt hæmoglobin (HPFH) 01-01-2012
DD568 Anden form for talassæmi 01-01-2012
DD569 Talassæmi UNS 01-01-1994
DD57 Seglcellesygdomme 01-01-1994
DD570 Seglcelleanæmi med krise 01-01-1994
DD571 Seglcelleanæmi uden krise 01-01-1994
DD572 Dobbelt heterozygot seglcelleanæmi 01-01-2012
DD572A Hb-SC sygdom 01-01-2012
DD572B Hb-SD sygdom 01-01-2012
DD572C Hb-SE sygdom 01-01-2012
DD572D Seglcelle talassæmi 01-01-2012
DD573 Heterozygot hæmoglobin S 01-01-1994
DD578 Anden form for seglcellesygdom 01-01-1994
DD58 Andre arvelige hæmolytiske anæmier 01-01-1994
DD580 Arvelig hæmolytisk anæmi forårsaget af sfærocytose 01-01-1994
DD580A Sphaerocytosis hereditaria 01-01-1994 31-12-2011
DD581 Arvelig hæmolytisk anæmi forårsaget af elliptocytose 01-01-1994
DD581A Medfødt elliptocytose 01-01-1994
DD582 Anden hæmoglobinopati 01-01-1994
DD582A Abnormt hæmoglobin UNS 01-01-2012
DD582B Medfødt Heinz Body anæmi 01-01-2012
DD582C Hb-C sygdom 01-01-2012
DD582D Hb-D sygdom 01-01-2012
DD582E Hb-E sygdom 01-01-2012
DD588 Anden arvelig hæmolytisk anæmi 01-01-1994
DD588A Stomatocytose 01-01-1994
DD589 Arvelig hæmolytisk anæmi UNS 01-01-1994
DD59 Erhvervede hæmolytiske anæmier 01-01-1994
DD590 Autoimmun hæmolytisk anæmi forårsaget af lægemiddel 01-01-1994
DD591 Anden autoimmun hæmolytisk anæmi 01-01-1994
DD591A Kuldeagglutininsyndrom 01-01-1994
DD592 Hæmolytisk ikke-autoimmun anæmi forårsaget af lægemiddel 01-01-1994
DD593 Hæmolytisk-uræmisk syndrom 01-01-1994
DD594 Anden hæmolytisk ikke-autoimmun anæmi 01-01-1994
DD594A Mekanisk hæmolytisk anæmi 01-01-1994
DD594B Mikroangiopatisk hæmolytisk anæmi 01-01-1994
DD594C Toksisk hæmolytisk anæmi 01-01-1994
DD595 Paroxysmal nokturn hæmoglobinuri 01-01-1994
DD596 Hæmoglobinuri ved hæmolyse forårsaget af anden ydre årsag 01-01-1994
DD596A Kuldehæmoglobinuri 01-01-1994
DD596B Marchhæmoglobinuri 01-01-1994
DD598 Anden erhvervet hæmolytisk anæmi 01-01-1994
DD599 Erhvervet hæmolytisk anæmi UNS 01-01-1994
DD599A Idiopatisk (kronisk) hæmolytisk anæmi 01-01-2012
DD60 Erhvervet pure red cell aplasi 01-01-1994
DD600 Kronisk erhvervet pure red cell aplasi 01-01-1994
DD601 Forbigående erhvervet pure red cell aplasi 01-01-1994
DD608 Anden erhvervet pure red cell aplasi 01-01-1994
DD609 Erhvervet pure red cell aplasi UNS 01-01-1994
DD61 Andre aplastiske anæmier 01-01-1994
DD610 Konstitutionel aplastisk anæmi 01-01-1994
DD610A Blackfan-Diamond syndrom 01-01-1994
DD610B Fanconis anæmi 01-01-1994
DD610C Pancytopeni med misdannelser 01-01-1994
DD610D Familiær hypoplastisk anæmi 01-01-2012
DD610E Aplasi af røde blodlegemer hos barn (medfødt)(primær) 01-01-2012
DD611 Aplastisk anæmi forårsaget af lægemiddel 01-01-1994
DD612 Aplastisk anæmi forårsaget af anden ydre påvirkning 01-01-1994
DD613 Idiopatisk aplastisk anæmi 01-01-1994
DD618 Anden aplastisk anæmi 01-01-1994
DD619 Aplastisk anæmi UNS 01-01-1994
DD619A Pancytopeni UNS 01-01-1994
DD619B Hypoplastisk anæmi UNS 01-01-2012
DD619C Medullær hypoplasi 01-01-2012
DD619D Panmyelophthisis 01-01-2012
DD62 Akut anæmi efter blødning 01-01-1994
DD629 Akut blødningsanæmi UNS 01-01-1994
DD63 Anæmi ved kroniske sygdomme klassificeret andetsteds 01-01-1994
DD630 Anæmi ved neoplastisk sygdom 01-01-1994
DD638 Anæmi ved anden kronisk sygdom klassificeret andetsteds 01-01-1994
DD64 Andre anæmier 01-01-1994
DD640 Arvelig sideroblastær anæmi 01-01-1994
DD640A Kønsbunden hypokrom sideroblastær anæmi 01-01-2012
DD641 Sekundær sideroblastær anæmi forårsaget af anden sygdom 01-01-1994
DD642 Sekundær sideroblastær anæmi f.a. lægemiddel eller toksin 01-01-1994
DD642A Anaemia sideroblastica medicamentalis 01-01-1994 31-12-2011
DD642B Anaemia sideroblastica toxica 01-01-1994 31-12-2011
DD643 Anden sideroblastær anæmi 01-01-1994
DD643A Sideroblastær anæmi UNS 01-01-1994
DD644 Medfødt dyserytropoietisk anæmi 01-01-1994
DD648 Anden anæmi 01-01-1994
DD648A Leukoerytroblastær anæmi 01-01-1994
DD648B Infantil pseudoleukæmi 01-01-2012
DD649 Anæmi UNS 01-01-1994
DD65 Dissemineret intravaskulær koagulation 01-01-1994
DD659 Dissemineret intravaskulær koagulation 01-01-1994
DD659A Erhvervet afibrinogenæmi 01-01-1994
DD659B Erhvervet fibrinolytisk blødning 01-01-1994
DD659C Fibrinolytisk purpura 01-01-1994
DD659D Purpura fulminans 01-01-2012
DD66 Arvelig faktor VIII-mangel 01-01-1994
DD669 Hæmofili A 01-01-1994
DD669A Hæmofili UNS 01-01-2012 30-06-2022
DD669B Hæmofili A, symptomatisk hos kvindelig bærer 01-07-2022
DD669C Hæmofili A mild 01-07-2022
DD669D Hæmofili A moderat 01-07-2022
DD669E Hæmofili A svær 01-07-2022
DD67 Arvelig faktor IX-mangel 01-01-1994
DD679 Hæmofili B 01-01-1994
DD679A Hæmofili B, symptomatisk hos kvindelig bærer 01-07-2022
DD679B Hæmofili B mild 01-07-2022
DD679C Hæmofili B moderat 01-07-2022
DD679D Hæmofili B svær 01-07-2022
DD68 Andre koagulationsdefekter 01-01-1994
DD680 Von Willebrands sygdom 01-01-1994
DD681 Arvelig faktor XI-mangel 01-01-1994
DD682 Arvelig mangel på andre koagulationsfaktorer 01-01-1994
DD682A Medfødt afibrinogenæmi 01-01-1994
DD683 Blødningsforstyrrelse f.a. cirkulerende antikoagulantia 01-01-1994
DD683A Hyperheparinæmi 01-01-1994
DD684 Erhvervet koagulationsfaktormangel 01-01-1994
DD684A Erhvervet koagulationsfaktormangel ved hypoprothrombinæmi 01-01-1994
DD684B Erhvervet koagulationsfaktormangel f.a. K-vitaminmangel 01-01-1994
DD684C Erhvervet koagulationsfaktormangel forårsaget af leversygdom 01-01-1994
DD685 Primær trombofili 01-01-1999
DD685A Koagulationsfaktor V Leiden mutation bp 1691 (heterozygot) 01-01-1999
DD685B Koagulationsfaktor V Leiden mutation bp 1691 (homozygot) 01-01-1999
DD685C Koagulationsfaktor V, mutation bp 4070 (heterozygot) 01-01-1999 30-06-2003
DD685D Koagulationsfaktor V, mutation bp 4070 (homozygot) 01-01-1999 30-06-2003
DD685E Prothrombin, mutation bp 20210 (heterozygot) 01-01-1999
DD685F Prothrombin, mutation bp 20210 (homozygot) 01-01-1999
DD685G Methylenetetrahydrofolat reduktase, mutat.bp 677 (homozygot) 01-01-1999 31-03-2019
DD685K Protein C mangel 01-01-2012
DD685L Protein S mangel 01-01-2012
DD685M Antithrombin III mangel 01-01-2012
DD686 Anden trombofili 01-01-1999
DD686A Protein C mangel 01-01-1999 31-12-2011
DD686B Protein S mangel 01-01-1999 31-12-2011
DD686C Antithrombin III mangel 01-01-1999 31-12-2011
DD686D Antifosfolipidantistofsyndrom 01-01-2012 31-03-2016
DD686E Kardiolipinantistofsyndrom 01-01-2012
DD686F Antifosfolipidsyndrom 01-04-2016
DD686G Vaccineinduceret immun trombotisk trombocytopeni (VITT) 01-12-2020
DD688 Anden koagulationsdefekt 01-01-1994
DD689 Koagulationsdefekt UNS 01-01-1994
DD69 Purpura og andre tilstande med blødningstendens 01-01-1994
DD690 Allergisk purpura 01-01-1994
DD690A Purpura anaphylactica 01-01-1994
DD690B Schönlein-Henochs purpura 01-01-1994
DD690C Purpura non thrombocytopenica haemorrhagica 01-01-1994
DD690D Purpura non thrombocytopenica idiopathica 01-01-1994
DD690E Purpura vascularis 01-01-1994
DD690F Vasculitis allergica 01-01-1994
DD691 Blodpladedefekter 01-01-1994
DD691A Bernard-Soulier syndrom 01-01-1994
DD691B Glanzmanns trombasteni 01-01-1994
DD691C Trombasteni (hæmoragisk) (hereditær) 01-01-1994
DD692 Anden purpura uden trombocytmangel eller defekt 01-01-1994
DD692A Purpura fibrinolytica 01-01-1994 31-12-2011
DD692B Purpura senilis 01-01-1994
DD692C Purpura simplex 01-01-1994
DD692D Purpura UNS 01-01-1994
DD692E Purpura annularis telangiectodes 01-04-2000
DD692F Gardner-Diamonds syndrom 01-04-2000
DD692H Purpura hyperglobulinaemica 01-01-2012
DD693 Idiopatisk trombocytopenisk purpura 01-01-1994
DD693A Thrombopenia essentialis 01-01-1994 31-12-2011
DD694 Anden primær trombocytopeni 01-01-1994
DD694A Føtal og neonatal alloimmun trombocytopeni (FNAIT) 01-07-2018
DD695 Sekundær trombocytopeni 01-01-1994
DD696 Trombocytopeni UNS 01-01-1994
DD698 Anden tilstand med blødningstendens 01-01-1994
DD698A Fragilitas capillaris (hereditaria) 01-01-1994
DD698B Vaskulær pseudohæmofili 01-01-1994
DD699 Blødningstendens UNS 01-01-1994
DD70 Neutropeni 01-01-1994
DD709 Neutropeni UNS 01-01-1994
DD709A Neutropeni og agranulocytose forårsaget af lægemiddel 01-01-1994
DD709B Toksisk neutropeni 01-01-1994
DD709C Medfødt neutropeni 01-01-1994
DD709D Cyklisk neutropeni 01-01-1994
DD709E Neutropenisk splenomegali 01-01-2012
DD71 Funktionelle forstyrr. i polymorfkærnede neutrofile celler 01-01-1994
DD719 Funktionelle forstyrr. i polymorfkærnede neutrofile cel UNS 01-01-1994
DD719A Medfødt dysfagocytose 01-01-1994
DD719B Progressiv septisk granulomatose 01-01-1994
DD719C Kronisk granulomatøs sygdom hos børn 01-01-1994
DD719D Defekt i cellemembranreceptorkomplex (CR3) 01-01-2012
DD72 Andre forstyrrelser i hvide blodlegemer 01-01-1994
DD720 Genetisk betinget leukocytanomali 01-01-1994
DD720A Alder's anomali 01-01-1994
DD720B Hereditær leukocytær hypersegmentation 01-01-1994
DD720C Hereditær leukocytær hyposegmentation 01-01-1994
DD720D Hereditær leukomelanopati 01-01-1994
DD720E May-Hegglins anomali 01-01-1994
DD720F Pelger-Huëts anomali 01-01-1994
DD721 Eosinofili 01-01-1994
DD721A Allergisk eosinofili 01-01-1994
DD721B Hereditær eosinofili 01-01-1994
DD721C Hypereosinofilt syndrom 01-01-2000 31-12-2011
DD728 Anden forstyrrelse i hvide blodlegemer 01-01-1994
DD728A Leukocytose 01-01-1994
DD728B Leukæmoid reaktion 01-01-1994
DD728C Lymfocytose (symptomatisk) 01-01-1994
DD728D Lymfopeni 01-01-1994
DD728E Monocytose (symptomatisk) 01-01-1994
DD728F Plasmacytose 01-01-1994
DD728G Pseudolymfom 01-04-2000
DD728H Leukopeni 01-07-2006
DD729 Sygdom i hvide blodlegemer UNS 01-01-1994
DD73 Sygdomme i milten 01-01-1994
DD730 Nedsat miltfunktion 01-01-1994
DD730A Atrofi af milten 01-01-1994
DD730B Erhvervet mangel af milten 01-01-1994
DD731 Øget miltfunktion 01-01-1994
DD732 Kronisk stasemilt 01-01-1994
DD733 Miltabsces 01-01-1994
DD734 Miltcyste 01-01-1994
DD735 Miltinfarkt 01-01-1994
DD735A Spontan miltruptur 01-01-1994
DD735B Milttorsion 01-01-1994
DD738 Anden sygdom i milten 01-01-1994
DD738A Fibrosis lienis 01-01-1994
DD738B Hypersplenismus 01-01-1994 31-12-2011
DD738C Perisplenitis 01-01-1994
DD738D Splenitis UNS 01-01-1994
DD739 Sygdom i milten UNS 01-01-1994
DD74 Methæmoglobinæmi 01-01-1994
DD740 Medfødt methæmoglobinæmi 01-01-1994
DD740A Medfødt methæmoglobinreduktasemangel 01-01-1994
DD740B Hæmoglobin-M (Hb-M) sygdom 01-01-2012
DD748 Anden methæmoglobinæmi 01-01-1994
DD748A Erhvervet methæmoglobinæmi 01-01-1994
DD748B Toksisk methæmoglobinæmi 01-01-1994
DD748C Sulfhæmoglobinæmi 01-01-1994
DD749 Methæmoglobinæmi UNS 01-01-1994
DD75 Andre sygdomme i blod og bloddannende organer 01-01-1994
DD750 Familiær polycytæmi 01-01-1994
DD751 Sekundær polycytæmi 01-01-1994
DD751A Polycythaemia nephrogenica 01-01-1994 31-12-2011
DD751B Polycythaemia secundaria 01-01-1994 31-12-2011
DD751C Højdebetinget polycytæmi 01-01-1994
DD751D Erythropoietin-induceret polycytæmi 01-01-2012
DD751E Hypoxisk polycytæmi 01-01-2012
DD751F Sekundær erytrocytose 01-01-2012
DD751G Sekundær trombocytose 01-01-2012
DD751H Sekundær leukocytose 01-01-2012
DD752 Thrombocytosis essentialis 01-01-1994 31-12-2011
DD758 Anden sygdom i blod eller bloddannende væv 01-01-1994
DD758A Basophilia 01-01-1994 31-12-2011
DD758B Thrombocytosis secundaria 01-01-2004 31-12-2011
DD758C Idiopatisk cytopeni af ukendt signifikans (ICUS) 01-01-2017
DD758D Klonal cytopeni af ukendt signifikans (CCUS) 01-01-2017
DD759 Sygdom i blod eller bloddannende væv UNS 01-01-1994
DD76 An. sygd, involv. lymforetikulære/retikulohistiocytære væv 01-01-1994
DD760 Histiocytose i de Langerhanske celler 01-01-1994 31-12-2011
DD760A Granuloma eosinophilicum 01-01-1994 31-12-2011
DD760B Hand-Schüller-Christians sygdom 01-01-1994 31-12-2011
DD760C Histiocytosis X chronica 01-01-1994 31-12-2011
DD761 Hæmofagocytær lymfhistiocytose 01-01-1994
DD761A Familiær hæmofagocytær retikulose 01-01-2012
DD762 Hæmofagocytært syndrom, infektionsassocieret 01-01-1994
DD763 Andet histiocytært syndrom 01-01-1994
DD763A Retikulohistiocytom (gigantocellulært) 01-01-1994
DD763B Xanthogranulom 01-01-1994
DD763C Juvenilt xanthogranulom 01-04-2000 31-12-2011
DD763D Sinus histiocytose med massiv lymfadenopati 01-01-2012
DD77 Andre sygdomme i blod og bloddannende organer v. sygdomme KA 01-01-1994
DD779 Sygdom i blod og bloddannende organer ved sygdom KA 01-01-1994
DD779A Fibrose i milt ved sygdom klassificeret andetsteds 01-01-2012
DD80 Immundefekt med overvejende antistofmangel 01-01-1994
DD800 Arvelig hypogammaglobulinæmi 01-01-1994
DD800A Autosomal recessiv agammaglobulinæmi (Swiss type) 01-01-1994
DD800B X-bundet agammaglobulinæmi med væksthormonmangel 01-01-1994
DD801 Ikke-familiær hypogammaglobulinæmi 01-01-1994
DD801A Hypogammaglobulinæmi UNS 01-01-1994
DD801B Agammaglobulinæmi med immunglobulinbærende B-lymfocyter 01-01-2012
DD801C Common variable agammaglobulinemia (CVA-gamma) 01-01-2012
DD802 Selektiv IgA-mangel 01-01-1994
DD803 Selektiv IgG-mangel 01-01-1994
DD804 Selektiv IgM-mangel 01-01-1994
DD805 Immundefekt med øget IgM 01-01-1994
DD806 Antistofmangel med hyperimmunglobulinæmi 01-01-1994
DD807 Hypogammaglobulinaemia neonatorum transitoria 01-01-1994
DD808 Anden immundefekt med overvejende antistofmangel 01-01-1994
DD808A Kappa light chain-mangel 01-01-1994
DD809 Immundefekt med overvejende antistofmangel UNS 01-01-1994
DD81 Kombinerede immundefekter 01-01-1994
DD810 Svær kombineret immundefekt (SCID) med retikulær dysgenesi 01-01-1994
DD811 Svær kombineret immundefekt (SCID), lavt antal T-/B-celler 01-01-1994
DD812 Svær kombineret immundefekt (SCID), lavt/norm antal B-celler 01-01-1994
DD813 Adenosindeaminase (ADA) mangel 01-01-1994
DD814 Nezelofs syndrom 01-01-1994
DD815 Purinnukleosidfosforylase (PNP) mangel 01-01-1994
DD816 Histokompatibilitetskompleksmangel, klasse I 01-01-1994
DD817 Histokompatibilitetskompleksmangel, klasse II 01-01-1994
DD818 Anden kombineret immundefekt 01-01-1994
DD819 Kombineret immundefekt UNS 01-01-1994
DD819A Svær kombineret immundefekt (SCID) UNS 01-01-2012
DD82 Immundefekt ifm andre alvorlige defekter 01-01-1994
DD820 Wiskott-Aldrichs syndrom 01-01-1994
DD821 DiGeorges syndrom 01-01-1994
DD821A Aplasia thymi med immundefekt 01-01-1994 31-12-2011
DD822 Immundefekt med korte ekstremiteter 01-01-1994
DD823 Immundefekt ved abnorm reaktion på Epstein-Barr virus 01-01-1994
DD823A Kønsbunden lymfoproliferativ sygdom 01-01-2012
DD824 Hyperimmunoglobin E (IgE) syndrom 01-01-1994
DD828 Immundefekt ved andre større specificerede defekter 01-01-1994
DD829 Immundefekt associeret med større defekt UNS 01-01-1994
DD83 Almindelige variable immundefekter 01-01-1994
DD830 Immundefekt med overvejende abnormt B-celletal og -funktion 01-01-1994
DD831 Immundefekt med overvejende forstyrrelse i T-celler 01-01-1994
DD832 Immundefekt med autoantistoffer mod B- eller T-celler 01-01-1994
DD838 Anden almindelig variabel immundefekt 01-01-1994
DD839 Almindelig variabel immundefekt UNS 01-01-1994
DD84 Andre immundefekter 01-01-1994
DD840 Defekt i lymfocytfunktionsantigen-1 01-01-1994
DD841 Defekt i komplementsystemet 01-01-1994
DD841A Hereditært angioødem 01-04-2000
DD841B C1-esteraseinhibitor-mangel 01-01-2012
DD848 Anden immundefekt 01-01-1994
DD849 Immundefekt UNS 01-01-1994
DD86 Sarkoidose 01-01-1994
DD860 Sarkoidose i lunger 01-01-1994
DD861 Sarkoidose i lymfeknuder 01-01-1994
DD862 Sarkoidose i både lunger og lymfeknuder 01-01-1994
DD863 Sarkoidose i hud 01-01-1994
DD863A Lupus pernio 01-04-2000
DD868 Sarkoidose med anden lokalisation eller flere lokalisationer 01-01-1994
DD868A Febris uveoparotidea (Heerfordt) 01-01-1994
DD868B Sarcoidosis articuli 01-01-1994 31-12-2011
DD868C Sarcoidosis hepatis 01-01-1994 31-12-2011
DD868D Sarcoidosis med iridocyclitis chronica 01-01-1994 31-12-2011
DD868E Sarcoidosis musculi 01-01-1994 31-12-2011
DD868F Sarcoidosis myocardii 01-01-1994 31-12-2011
DD868G Akut sarkoidose UNS 01-01-2012
DD869 Sarkoidose UNS 01-01-1994
DD89 Andre forstyrrelser i immunsystemet IKA 01-01-1994
DD890 Polyklonal hypergammaglobulinæmi 01-01-1994
DD890A Polyklonal gammopati UNS 01-01-1994
DD890B Benign hypergammaglobulinæmisk purpura 01-01-1994
DD891 Kryoglobulinæmi 01-01-1994
DD891A Cryoglobulinaemia idiopathica 01-01-1994 31-12-2011
DD891B Cryoglobulinaemia mixta 01-01-1994 31-12-2011
DD891C Cryoglobulinaemia primaria 01-01-1994 31-12-2011
DD891D Cryoglobulinaemia secundaria 01-01-1994 31-12-2011
DD891E Purpura cryoglobulinaemica 01-01-1994 31-12-2011
DD891F Vasculitis cryoglobulinaemica 01-01-1994 31-12-2011
DD891G Cryofibrinogenaemia 01-04-2000 31-12-2011
DD892 Hypergammaglobulinæmi UNS 01-01-1994
DD898 Anden forstyrrelse i immunsystemet IKA 01-01-1994
DD899 Sygdom i immunsystemet UNS 01-01-1994
DE00 Medfødt jodmangelsyndrom 01-01-1994
DE000 Medfødt jodmangelsyndrom med neurologiske symptomer 01-01-1994
DE001 Medfødt jodmangelsyndrom med myksødem 01-01-1994
DE002 Medfødt jodmangelsyndrom af blandet form 01-01-1994
DE009 Medfødt jodmangelsyndrom UNS 01-01-1994
DE01 Jodmangel-relaterede lidelser i skjoldbruskkirtlen 01-01-1994
DE010 Endemisk diffus struma forårsaget af jodmangel 01-01-1994
DE010A Struma diffusa non toxica endemica 01-01-1994 31-12-2011
DE011 Endemisk knudestruma forårsaget af jodmangel 01-01-1994
DE011A Struma nodosa non toxica endemica 01-01-1994 31-12-2011
DE012 Endemisk jodmangel struma UNS 01-01-1994
DE018 Anden struma el. beslægtet tilstand forårsaget af jodmangel 01-01-1994
DE02 Kompenseret jodmangelbetinget myksødem 01-01-1994
DE029 Kompenseret jodmangelbetinget myksødem UNS 01-01-1994
DE03 Anden hypothyroidisme 01-01-1994
DE030 Medfødt myksødem med diffus struma 01-01-1994
DE030A Medfødt myksødem UNS 01-01-1994
DE031 Medfødt myksødem uden struma 01-01-1994
DE031A Aplasi af skjoldbruskkirtlen med myksødem 01-01-1994
DE031B Medfødt hypoplasi af skjoldbruskkirtlen 01-01-1994
DE031C Medfødt hypothyroidisme UNS 01-01-1994
DE032 Hypothyroidisme f.a. lægemiddel eller andet fremmed agens 01-01-1994
DE033 Myksødem efter infektion 01-01-1994
DE034 Erhvervet atrofi af skjoldbruskkirtlen 01-01-1994
DE035 Myksødematøs koma 01-01-1994
DE038 Anden form for hypothyroidisme 01-01-1994
DE039 Hypothyroidisme UNS 01-01-1994
DE04 Anden atoksisk struma 01-01-1994
DE040 Atoksisk diffus struma 01-01-1994
DE041 Atoksisk struma med solitært adenom 01-01-1994
DE041A Adenoma thyreoideae 01-01-1994 31-12-2011
DE042 Atoksisk multinodøs struma 01-01-1994
DE042A Cystisk struma UNS 01-01-1994
DE048 Anden form for atoksisk struma 01-01-1994
DE048A Atoksisk recidivstruma 01-01-1994
DE049 Atoksisk struma UNS 01-01-1994
DE05 Thyrotoksikose 01-01-1994
DE050 Thyrotoksikose med diffus struma 01-01-1994
DE050A Basedow's sygdom 01-01-1994 31-12-2011
DE050B Graves' sygdom 01-01-1994 31-12-2011
DE050C Thyreotoxicosis med diffus struma 01-01-1994 31-12-2011
DE050D Thyreotoxicosis uden struma 01-01-1994 31-12-2011
DE051 Thyrotoksikose med toksisk solitært adenom 01-01-1994
DE052 Thyrotoksikose med toksisk multinodøs struma 01-01-1994
DE052A Toksisk nodøs struma UNS 01-01-2012
DE053 Thyrotoksikose forårsaget af ektopisk thyroideavæv 01-01-1994
DE054 Thyrotoksikose ved overdosering af thyroideahormon 01-01-1994
DE055 Thyrotoksisk krise 01-01-1994
DE058 Anden form for thyrotoksikose 01-01-1994
DE058A Hyperthyreose ved overprod. af thyroideastim. hormon (TSH) 01-01-1994
DE058B Toksisk redicivstruma 01-01-1994
DE058C Thyrotoksikose uden struma 01-01-2012
DE059 Thyrotoksikose UNS 01-01-1994
DE059A Thyrotoksisk hjertesygdom 01-01-1994
DE06 Betændelse i skjoldbruskkirtlen 01-01-1994
DE060 Akut thyroiditis 01-01-1994
DE060A Absces i skjoldbruskkirtlen 01-01-1994
DE060B Thyroiditis suppurativa 01-01-1994
DE061 Subakut thyroiditis 01-01-1994
DE061A De Quervain's tyreoiditis 01-01-1994 31-12-2011
DE061B Kæmpecelle thyreoiditis 01-01-1994 31-12-2011
DE061C Thyroiditis non suppurativa 01-01-1994
DE062 Kronisk thyroiditis med forbigående thyrotoksikose 01-01-1994
DE063 Autoimmun thyroiditis 01-01-1994
DE063A Hashimotos thyroiditis 01-01-1994
DE063B Struma lymphomatosa 01-01-1994
DE063C Thyreoiditis lymphocytica 01-01-1994 31-12-2011
DE064 Thyroiditis forårsaget af lægemiddel 01-01-1994
DE065 Anden kronisk betændelse i skjoldbruskkirtlen 01-01-1994
DE065A Thyroiditis fibrosa 01-01-1994
DE065B Thyroiditis lignosa 01-01-1994
DE065C Riedels struma 01-01-1994
DE065D Kronisk thyroiditis UNS 01-01-2012
DE069 Betændelse i skjoldbruskkirtlen UNS 01-01-1994
DE07 Andre sygdomme i skjoldbruskkirtlen 01-01-1994
DE070 Forøget sekretion af kalcitonin 01-01-1994
DE070A C-celle hyperplasi af skjoldbruskkirtlen 01-01-1994
DE070B Calcitonin, forøget sekretion af 01-01-1994 31-12-2011
DE071 Dyshormogenetisk struma 01-01-1994
DE071A Pendreds syndrom 01-01-1994
DE071B Familiær dyshormogen struma 01-01-1994
DE078 Anden forstyrrelse i skjoldbruskkirtlen 01-01-1994
DE078A Atrophia glandulae thyreoideae 01-01-1994 31-12-2011
DE078B Blødning i skjoldbruskkirtlen 01-01-1994
DE078C Infarkt i skjoldbruskkirtlen 01-01-1994
DE078D Sick-euthyroid syndrom 01-01-1994
DE078E Abnormitet i thyroidea-bindende globulin 01-01-1994
DE079 Forstyrrelse i skjoldbruskkirtlen UNS 01-01-1994
DE10 Type 1-diabetes 01-01-1994
DE100 Type 1-diabetes med koma 01-01-1994
DE100A Coma diabeticum, hyperosmolær ved IDDM 01-01-1994 31-12-2011
DE100B Coma diabeticum ved IDDM med ketoacidose 01-01-1994 31-12-2011
DE100C Coma diabeticum ved IDDM uden ketoacidose 01-01-1994 31-12-2011
DE100D Coma diabeticum, hyperglykæmisk ved IDDM 01-01-1994 31-12-2011
DE100E Coma diabeticum, hypoglykæmisk ved IDDM 01-01-1994 31-12-2011
DE100F Diabetes mellitus insulino dependente med coma diabeticum 01-01-1994 31-12-2011
DE101 Type 1-diabetes med ketoacidose 01-01-1994
DE102 Type 1-diabetes med nyrekomplikation 01-01-1994
DE103 Type 1-diabetes med øjenkomplikation 01-01-1994
DE104 Type 1-diabetes med neurologisk komplikation 01-01-1994
DE105 Type 1-diabetes med komplikationer i perifere karsystem 01-01-1994
DE105A Type 1-diabetes med perifer angiopati 01-01-1994
DE105B Type 1-diabetes med fodsår 01-01-1994
DE105C Type 1-diabetes med gangræn 01-01-1994
DE105D Type 1-diabetes med mikroangiopati 01-01-1994
DE106 Type 1-diabetes med anden komplikation 01-01-1994
DE107 Type 1-diabetes med multiple komplikationer 01-01-1994
DE108 Type 1-diabetes med komplikation UNS 01-01-1994
DE109 Type 1-diabetes uden komplikationer 01-01-1994
DE109A Type 1-diabetes UNS 01-10-2003
DE11 Type 2-diabetes 01-01-1994
DE110 Type 2-diabetes med koma 01-01-1994
DE110A Coma diabeticum ved NIDDM uden ketoacidose 01-01-1994 31-12-2011
DE110B Coma diabeticum, hypoglykæmisk ved NIDDM 01-01-1994 31-12-2011
DE110C Coma diabeticum, hyperosmolær ved NIDDM 01-01-1994 31-12-2011
DE110D Coma diabeticum, hyperglykæmisk ved NIDDM 01-01-1994 31-12-2011
DE110E Coma diabeticum ved NIDDM med ketoacidose 01-01-1994 31-12-2011
DE111 Type 2-diabetes med ketoacidose 01-01-1994
DE112 Type 2-diabetes med nyrekomplikation 01-01-1994
DE113 Type 2-diabetes med øjenkomplikation 01-01-1994
DE114 Type 2-diabetes med neurologisk komplikation 01-01-1994
DE115 Type 2-diabetes med komplikationer i perifere karsystem 01-01-1994
DE115A Type 2-diabetes med perifer angiopati 01-01-1994
DE115B Type 2-diabetes med fodsår 01-01-1994
DE115C Type 2-diabetes med gangræn 01-01-1994
DE115D Type 2-diabetes med mikroangiopati 01-01-1994
DE116 Type 2-diabetes med anden komplikation 01-01-1994
DE117 Type 2-diabetes med multiple komplikationer 01-01-1994
DE118 Type 2-diabetes med komplikation UNS 01-01-1994
DE119 Type 2-diabetes uden komplikationer 01-01-1994
DE119A Type 2-diabetes UNS 01-10-2003
DE12 Diabetes forårsaget af underernæring 01-01-1994
DE120 Diabetes forårsaget af underernæring med koma 01-01-1994
DE120A Coma diabeticum, hyperglykæmisk ved diab mell malnutritioni 01-01-1994 31-12-2011
DE120B Coma diabeticum, hypoglykæmisk ved diab mell malnutritionis 01-01-1994 31-12-2011
DE120C Coma diabeticum ved diab mell malnutrit med ketoacidose 01-01-1994 31-12-2011
DE120D Coma diabeticum ved diab mell malnutrit uden ketoacidose 01-01-1994 31-12-2011
DE120E Coma diabeticum, hyperosmolær ved diab mell malnutritionis 01-01-1994 31-12-2011
DE121 Diabetes forårsaget af underernæring med ketoacidose 01-01-1994
DE122 Diabetes forårsaget af underernæring med nyrekomplikation 01-01-1994
DE123 Diabetes forårsaget af underernæring med øjenkomplikation 01-01-1994
DE124 Diabetes f.a. underernæring med neurologisk komplikation 01-01-1994
DE125 Diabetes f.a. underernæring med kompl. i perifere karsystem 01-01-1994
DE125A Diabetes forårsaget af underernæring med perifer angiopati 01-01-1994
DE125B Diabetes forårsaget af underernæring med fodsår 01-01-1994
DE125C Diabetes forårsaget af underernæring med gangræn 01-01-1994
DE125D Diabetes forårsaget af underernæring med mikroangiopati 01-01-1994
DE126 Diabetes forårsaget af underernæring med anden komplikation 01-01-1994
DE127 Diabetes f.a. underernæring med multiple komplikationer 01-01-1994
DE128 Diabetes forårsaget af underernæring med komplikation UNS 01-01-1994
DE129 Diabetes forårsaget af underernæring uden komplikationer 01-01-1994
DE13 Andre former for diabetes 01-01-1994
DE130 Anden diabetes med koma 01-01-1994
DE131 Anden diabetes med ketoacidose 01-01-1994
DE132 Anden diabetes med nyrekomplikation 01-01-1994
DE133 Anden diabetes med øjenkomplikationer 01-01-1994
DE134 Anden diabetes med neurologisk komplikation 01-01-1994
DE135 Anden diabetes med komplikationer i perifere karsystem 01-01-1994
DE135A Anden diabetes med perifer angiopati 01-01-2012
DE135B Anden diabetes med fodsår 01-01-2012
DE135C Anden diabetes med gangræn 01-01-2012
DE135D Anden diabetes med mikroangiopati 01-01-2012
DE136 Anden diabetes med anden komplikation 01-01-1994
DE137 Anden diabetes med multiple komplikationer 01-01-1994
DE138 Anden diabetes med komplikation UNS 01-01-1994
DE139 Anden diabetes uden komplikationer 01-01-1994
DE14 Ikke spec. diabetes 01-01-1994
DE140 Diabetes UNS med koma 01-01-1994
DE140A Coma diabeticum ved diabetes mellitus uden specifikation 01-01-1994 31-12-2011
DE140B Coma diabeticum, hyperglykæmisk ved diab mell uden specifik 01-01-1994 31-12-2011
DE140C Coma diabeticum, hyperosmolær ved diab mell uden specifik 01-01-1994 31-12-2011
DE140D Coma diabeticum, hypoglykæmisk ved diab mell uden specifik 01-01-1994 31-12-2011
DE141 Diabetes UNS med ketoacidose 01-01-1994
DE142 Diabetes UNS med nyrekomplikation 01-01-1994
DE143 Diabetes UNS med øjenkomplikation 01-01-1994
DE144 Diabetes UNS med neurologisk komplikation 01-01-1994
DE145 Diabetes UNS med komplikationer i perifere karsystem 01-01-1994
DE145A Diabetes UNS med perifer angiopati 01-01-1994
DE145B Diabetes UNS med fodsår 01-01-1994
DE145C Diabetes UNS med gangræn 01-01-1994
DE145D Diabetes UNS med mikroangiopati 01-01-1994
DE146 Diabetes UNS med anden komplikation 01-01-1994
DE147 Diabetes UNS med multiple komplikationer 01-01-1994
DE148 Diabetes UNS med komplikation UNS 01-01-1994
DE149 Diabetes UNS uden komplikationer 01-01-1994
DE15 Ikke-diabetisk hypoglykæmisk koma 01-01-1994
DE159 Hypoglykæmisk koma UNS 01-01-1994
DE159A Insulinshock 01-01-1994 31-12-2011
DE159B Hypoglykæmisk koma ved hyperinsulisme 01-01-2012
DE16 Andre forstyrrelser i bugspytkirtlens interne sekretion 01-01-1994
DE160 Hypoglykæmi uden koma forårsaget af lægemiddel 01-01-1994
DE161 Anden form for hypoglykæmi 01-01-1994
DE161A Betacellehyperplasi i pancreas med hyperinsulinisme 01-01-1994
DE161B Encefalopati efter hypoglykæmisk koma 01-01-1994
DE161C Funktionel hyperinsulinisme 01-01-1994
DE161D Hyperinsulinisme UNS 01-01-1994
DE162 Hypoglykæmi UNS 01-01-1994
DE163 Øget glukagonsekretion 01-01-1994
DE163A Betacellehyperplasi i pancreas med glukagonoverproduktion 01-01-2012
DE164 Abnorm gastrinsekretion 01-01-2012
DE164A Hypergastrinæmi 01-01-2012
DE164B Zollinger-Ellisons syndrom 01-01-2012
DE168 Andre forstyrrelser i pancreas interne sekretion 01-01-1994
DE168A Hypergastrinaemia 01-01-1994 31-12-2011
DE168B Øget sekretion af pankreatisk polypeptid (PPP) 01-01-1994
DE168C Øget sekretion af pankreatisk somatostatin (SS-14) 01-01-1994
DE168D Øget sekretion af pankreatisk vasoaktivt intest. polypeptid 01-01-1994
DE168E Zollinger-Ellison's syndrom 01-01-1994 31-12-2011
DE168F Øget sekretion af pankreatisk væksthormon releasing hormon 01-01-2012
DE169 Forstyrrelse i pancreas interne sekretion UNS 01-01-1994
DE169A Hyperplasi af pancreas endokrine celler UNS 01-01-2012
DE20 Hypoparathyroidisme 01-01-1994
DE200 Idiopatisk hypoparathyroidisme 01-01-1994
DE201 Pseudohypoparathyroidisme 01-01-1994
DE208 Anden hypoparathyroidisme 01-01-1994
DE209 Hypoparathyroidisme UNS 01-01-1994
DE209A Tetani efter parathyreoidectomia 01-01-1994 31-12-2011
DE21 Hyperparathyroidisme og andre sygdomme i biskjoldbruskkirtel 01-01-1994
DE210 Primær hyperparathyroidisme 01-01-1994
DE210A Hyperplasi af biskjoldbruskkirtel 01-01-1994
DE210B Osteitis fibrosa cystica generalisata 01-01-1994
DE211 Sekundær hyperparathyroidisme 01-01-1994
DE212 Anden form for hyperparathyroidisme 01-01-1994
DE212A Tertiær hyperparathyroidisme 01-01-2012
DE213 Hyperparathyroidisme UNS 01-01-1994
DE213A Hyperparathyroidismekrise 01-01-1994
DE213B Nephrocalcinosis ved hyperparathyreoidisme 01-01-1994 31-12-2011
DE214 Anden sygdom i biskjoldbruskkirtel 01-01-1994
DE215 Sygdom i biskjoldbruskkirtel UNS 01-01-1994
DE22 Øget aktivitet i hypofysen 01-01-1994
DE220 Hypofysær kæmpevækst eller akromegali 01-01-1994
DE220A Akromegali 01-01-1994
DE220B Arthropathia acromegaliae 01-01-1994 31-12-2011
DE220C Hypofysær kæmpevækst 01-01-1994
DE221 Hyperprolaktinæmi 01-01-1994
DE222 Øget sekretion af antidiuretisk hormon (ADH) 01-01-1994
DE222A Syndrome of inappropriate secretion of antidiuretic hormone 01-01-2012
DE228 Anden øget hypofyseaktivitet 01-01-1994
DE228A Pubertas praecox centralis 01-01-1994
DE229 Øget hypofyseaktivitet UNS 01-01-1994
DE23 Nedsat aktivitet og andre sygdomme i hypofysen 01-01-1994
DE230 Nedsat hormonsekretion fra hypofysen 01-01-1994
DE230A Isoleret nedsat sekretion af gonadotropin 01-01-1994
DE230B Isoleret nedsat sekretion af hypofysehormon UNS 01-01-1994
DE230C Isoleret nedsat sekretion af væksthormon 01-01-1994
DE230D Kallmanns syndrom 01-01-1994
DE230E Lorain-Levis dværgvækst 01-01-1994
DE230F Nekrose af hypofysen efter fødsel 01-01-1994
DE230G Sheehans syndrom 01-01-1994
DE230H Simmonds syndrom 01-01-1994
DE230I Hypofysær kakeksi 01-01-1994
DE231 Hypopituitarisme forårsaget af lægemiddel 01-01-1994
DE232 Diabetes insipidus 01-01-1994
DE233 Hypotalamisk dysfunktion IKA 01-01-1994
DE236 Anden sygdom i hypofysen 01-01-1994
DE236A Absces i hypofysen 01-01-1994
DE236B Dystrophia adiposogenitalis efter intrakraniel læsion 01-01-1994
DE236C Dystrophia adiposogenitalis 01-01-1994
DE236D Frölich's syndrom 01-01-1994 31-12-2011
DE236E Apoplexia pituitaria 01-01-2001
DE237 Sygdom i hypofysen UNS 01-01-1994
DE24 Cushings syndrom 01-01-1994
DE240 Hypofysært betinget Cushings sygdom 01-01-1994
DE241 Nelsons syndrom 01-01-1994
DE242 Cushings syndrom forårsaget af lægemiddel 01-01-1994
DE243 Ektopisk ACTH syndrom 01-01-1994
DE244 Alkoholinduceret pseudo-Cushings syndrom 01-01-1994
DE248 Anden form for Cushings syndrom 01-01-1994
DE249 Cushings syndrom UNS 01-01-1994
DE25 Adrenogenitale sygdomme 01-01-1994
DE250 Medfødt adrenogenitalt syndrom med enzymdefekt 01-01-1994
DE250A Adrenogenitalt syndrom, medfødt med enzymdefekt 01-01-1994 31-12-2011
DE250B Medfødt 21-hydroxylasemangel 01-01-1994
DE250C Medfødt salttabende binyrebarkhyperplasi 01-01-1994
DE250D Medfødt binyrebarkhyperplasi 01-01-2012
DE258 Anden form for adrenogenitalt syndrom 01-01-1994
DE258A Idiopatisk adrenogenitalt syndrom 01-01-2012
DE259 Adrenogenitalt syndrom UNS 01-01-1994
DE26 Hyperaldosteronisme 01-01-1994
DE260 Primær hyperaldosteronisme 01-01-1994
DE260A Conn's syndrom 01-01-1994 31-12-2011
DE260B Primær hyperaldosteronisme ved bilateral binyrehyperplasi 01-01-1994
DE261 Sekundær hyperaldosteronisme 01-01-1994
DE268 Anden form for hyperaldosteronisme 01-01-1994
DE268A Bartters syndrom 01-01-1994
DE269 Hyperaldosteronisme UNS 01-01-1994
DE27 Andre binyresygdomme 01-01-1994
DE270 Anden øget binyrebarksekretion 01-01-1994
DE270A Øget ACTH produktion uden Cushings sygdom 01-01-1994
DE270B Præmatur adrenarche 01-01-1994
DE271 Primær binyrebarkinsufficiens 01-01-1994
DE271A Addisons sygdom 01-01-1994
DE271B Autoimmun adrenalitis 01-01-1994
DE272 Addisonkrise 01-01-1994
DE272A Addison krise 01-01-1994 31-12-2011
DE273 Binyrebarkinsufficiens forårsaget af lægemiddel 01-01-1994
DE274 Anden og ikke spec. binyrebarkinsufficiens 01-01-1994
DE274A Binyrebarkinsufficiens UNS 01-01-1994
DE274B Blødning i binyre 01-01-1994
DE274C Anden binyrebarkinsufficiens 01-01-1994
DE274D Hypoaldosteronisme 01-01-1994
DE274E Binyreinfarkt 01-01-1994
DE275 Øget katekolaminsekretion 01-01-1994
DE275A Katekolamin, hypersekretion 01-01-1994 31-12-2011
DE278 Anden binyresygdom 01-01-1994
DE278A Abnormt kortisonbindende globulin 01-01-1994
DE279 Binyresygdom UNS 01-01-1994
DE28 Forstyrrelse i æggestokkenes funktion 01-01-1994
DE280 Øget østrogen niveau 01-01-1994
DE281 Øget androgen niveau 01-01-1994
DE282 Polycystisk ovariesyndrom (PCOS) 01-01-1994
DE282A Sklerocystisk ovariesyndrom 01-01-1994
DE282B Stein-Leventhal's syndrom 01-01-1994 31-12-2011
DE282C Polycystiske ovarier uden anovulation 01-01-2004
DE283 Primær ovarial hypofunktion 01-01-1994
DE283A Præmatur menopause UNS 01-01-1994
DE283B Østrogenresistenssyndrom 01-01-1994
DE288 Anden forstyrrelse i æggestokkenes funktion 01-01-1994
DE288A Ovarial hyperfunktion UNS 01-01-2012
DE289 Forstyrrelse i æggestokkenes funktion UNS 01-01-1994
DE29 Forstyrrelse i testiklernes funktion 01-01-1994
DE290 Testikulær hyperfunktion 01-01-1994
DE291 Testikulær hypofunktion 01-01-1994
DE291A Defekt testikulær androgensyntese 01-01-1994
DE291B 5-alfa-reduktase mangel med mandlig pseudohermafroditisme 01-01-1994
DE291C Testikulær hypogonadisme UNS 01-01-2012
DE298 Anden forstyrrelse i testiklernes funktion 01-01-1994
DE299 Forstyrrelse i testiklernes funktion UNS 01-01-1994
DE30 Hormonelle forstyrr. i puberteten IKA 01-01-1994
DE300 Konstitutionelt forsinket pubertet 01-01-1994
DE301 For tidlig pubertet 01-01-1994
DE308 Anden hormonel forstyrrelse i puberteten 01-01-1994
DE308A Præmatur thelarche 01-01-1994
DE309 Hormonel forstyrrelse i puberteten UNS 01-01-1994
DE31 Funktionsforstyrrelser i flere endokrine kirtler 01-01-1994
DE310 Autoimmun polyglandulær insufficiens 01-01-1994
DE310A Schmidts syndrom 01-01-1994
DE311 Polyglandulær hyperfunktion 01-01-1994
DE318 Anden polyglandulær funktionsforstyrrelse 01-01-1994
DE319 Polyglandulær funktionsforstyrrelse UNS 01-01-1994
DE32 Sygdomme i thymus 01-01-1994
DE320 Varig hyperplasi af thymus 01-01-1994
DE321 Absces i thymus 01-01-1994
DE328 Anden sygdom i thymus 01-01-1994
DE329 Sygdom i thymus UNS 01-01-1994
DE34 Sygdomme i andre endokrine kirtler 01-01-1994
DE340 Karcinoidt syndrom 01-01-1994
DE341 Anden øget sekretion af intestinale hormoner 01-01-1994
DE342 Ektopisk hormonsekretion IKA 01-01-1994
DE343 Lille højde IKA 01-01-1994
DE343A Dværgvækst af Laron-type 01-01-1994
DE343B Konstitutionel dværgvækst 01-01-1994
DE343C Nanismus psychosocialis 01-01-1994
DE344 Konstitutionel kæmpevækst 01-01-1994
DE345 Androgen-insensitivitetssyndrom 01-01-1994
DE345A Testikulær feminisering 01-01-1994
DE345B Mandlig pseudohermafroditisme ved androgeninsensivitet 01-01-1994
DE345C Reifenstein's syndrom 01-01-1994 31-12-2011
DE348 Anden sygdom i endokrine kirtler 01-01-1994
DE348A Dysfunktion af corpus pineale 01-01-1994
DE348B Progeria 01-01-1994
DE348C Werners syndrom 01-04-2000
DE349 Endokrin sygdom UNS 01-01-1994
DE35 Endokrine sygd. sfa sygd. KA 01-01-1994
DE350 Sygd. i skjoldbruskkirtel sfa sygdom KA 01-01-1994
DE351 Sygdom i binyre som følge af sygdom KA 01-01-1994
DE358 An. endokrin sygd. sfa sygdom KA 01-01-1994
DE40 Proteinmangelsygdom hos børn 01-01-1994
DE409 Proteinmangelsygdom hos børn UNS 01-01-1994
DE409A Kwashiorkor 01-01-1994 31-12-2011
DE41 Svækkelse forårsaget af underernæring 01-01-1994
DE419 Svækkelse forårsaget af underernæring UNS 01-01-1994
DE42 Svær afmagring som følge af protein- og energimangel 01-01-1994
DE429 Svær afmagring som følge af proteinmangel UNS 01-01-1994
DE43 Ikke spec. svær protein- og energimangelsygdom 01-01-1994
DE439 Svær protein- og energimangelsygdom UNS 01-01-1994
DE439A Hungerødem 01-01-1994
DE44 Moderat og mild protein- og energimangelsygdom 01-01-1994
DE440 Moderat protein- og energimangelsygdom 01-01-1994
DE441 Mild protein- og energimangelsygdom 01-01-1994
DE45 Forsinket udvikling som følge af protein- og energimangel 01-01-1994
DE459 Nedsat vækst som følge af underernæring 01-01-1994
DE46 Ikke spec. protein- og energiunderernæring 01-01-1994
DE469 Protein- og energiunderernæring UNS 01-01-1994
DE47 Anden undervægt 01-04-2003
DE470 Undervægt som følge af for lavt kalorieindtag, BMI<18,5 01-04-2003
DE50 A-vitaminmangel 01-01-1994
DE500 A-vitaminmangel med tørhed af konjunktiva 01-01-1994
DE501 A-vitaminmangel med Bitots pletter og øjentørhed 01-01-1994
DE502 A-vitaminmangel med tørhed i hornhinde 01-01-1994
DE503 A-vitaminmangel med kronisk sår og tørhed i hornhinde 01-01-1994
DE504 A-vitaminmangel med keratomalaci 01-01-1994
DE505 A-vitaminmangel med natteblindhed 01-01-1994
DE506 A-vitaminmangel med ar i hornhinden efter øjentørhed 01-01-1994
DE507 A-vitaminmangel med andre øjensymptomer 01-01-1994
DE507A A-vitaminmangel med xeroftalmi UNS 01-01-1994
DE508 A-vitaminmangel med anden manifestation 01-01-1994
DE508A Avitaminosis A med andre sygdomstegn uden specifikation 01-01-1994 31-12-2011
DE508B A-vitaminmangel med follikulær keratose 01-01-1994
DE508C A-vitaminmangel med xeroderma 01-01-1994
DE509 A-vitaminmangel UNS 01-01-1994
DE51 Tiaminmangel 01-01-1994
DE511 Beriberi 01-01-1994
DE511A Tør beriberi 01-01-1994
DE511B Våd beriberi 01-01-1994
DE512 Wernickes encefalopati 01-01-1994
DE513 Thiaminmangel med andre symptomer 01-01-1994 31-12-2011
DE518 Tiaminmangel med anden manifestation 01-01-2012
DE519 Tiaminmangel UNS 01-01-1994
DE52 Niacinmangel 01-01-1994
DE529 Niacinmangel UNS 01-01-1994
DE529A Alkoholisk pellagra 01-01-1994
DE53 Andre B-vitamin mangeltilstande 01-01-1994
DE530 Riboflavinmangel 01-01-1994
DE531 Pyridoxinmangel 01-01-1994
DE538 Anden B-vitaminmangel 01-01-1994
DE538A Folinsyremangel 01-01-1994
DE538B Pantotensyremangel 01-01-1994
DE538C Biotinmangel 01-01-1994
DE538D Cyanokobalaminmangel 01-01-1994
DE538E Folatmangel 01-01-1994
DE539 B-vitaminmangel UNS 01-01-1994
DE54 C-vitaminmangel 01-01-1994
DE549 C-vitaminmangel UNS 01-01-1994
DE55 D-vitaminmangel 01-01-1994
DE550 Aktiv rakitis 01-01-1994
DE559 D-vitaminmangel UNS 01-01-1994
DE56 Andre vitaminmangel-tilstande 01-01-1994
DE560 E-vitaminmangel 01-01-1994
DE561 K-vitaminmangel 01-01-1994
DE568 Anden vitaminmangel 01-01-1994
DE569 Vitaminmangel UNS 01-01-1994
DE58 Ernæringsbetinget kalciummangel 01-01-1994
DE589 Kalciummangel UNS 01-01-1994
DE59 Ernæringsbetinget selenmangel 01-01-1994
DE599 Selenmangel UNS 01-01-1994
DE599A Keshan's sygdom 01-01-1994 31-12-2011
DE60 Ernæringsbetinget zinkmangel 01-01-1994
DE609 Zinkmangel UNS 01-01-1994
DE609A Zinkmangel, akut 01-04-2000 31-12-2011
DE609B Zinkmangel, erhvervet (sekundær, akvisit) 01-04-2000 31-12-2011
DE609C Zinkmangel, kronisk 01-04-2000 31-12-2011
DE609D Zinkmangel, anden 01-04-2000 31-12-2011
DE61 Mangel på andre sporelementer 01-01-1994
DE610 Kobbermangel 01-01-1994
DE611 Jernmangel 01-01-1994
DE612 Magnesiummangel 01-01-1994
DE613 Manganmangel 01-01-1994
DE614 Krommangel 01-01-1994
DE615 Molybdænmangel 01-01-1994
DE616 Vanadiummangel 01-01-1994
DE617 Samtidig mangel på flere sporelementer 01-01-1994
DE618 Mangel på andet sporelement 01-01-1994
DE619 Sporelementmangel UNS 01-01-1994
DE63 Andre ernæringsbetingede mangeltilstande 01-01-1994
DE630 Mangel på essentielle fedtsyrer (EFA) 01-01-1994
DE631 Fejlernæring som følge af misforhold i fødens sammensætning 01-01-1994
DE638 Anden kostmangel 01-01-1994
DE639 Kostmangel UNS 01-01-1994
DE64 Følger eft underernæring og ernæringsbetingede mgl.tilstande 01-01-1994
DE640 Følger efter protein-energimangel 01-01-1994
DE641 Følger efter A-vitaminmangel 01-01-1994
DE642 Følger efter C-vitaminmangel 01-01-1994
DE643 Følger efter rakitis 01-01-1994
DE648 Følger efter anden ernæringsbetinget mangeltilstand 01-01-1994
DE648A Pseudoglukagonom syndrom 01-04-2000
DE648B KZ-syndrom 01-01-2012
DE649 Følger efter ernæringsbetinget mangeltilstand UNS 01-01-1994
DE649A KZ syndrom 01-01-1994 31-12-2011
DE649B Miseries dermatitis 01-04-2000 31-12-2011
DE65 Lokaliseret fedme 01-01-1994
DE658 Anden lokaliseret fedme 01-01-2001
DE658A Abdomen pendens 01-01-2001
DE658B Abdomen pendens postgestationis 01-10-2004
DE659 Lokaliseret fedme UNS 01-01-1994
DE66 Overvægt og fedme 01-01-1994
DE660 Fedme som følge af for stort kalorieindtag 01-01-1994
DE660A Overvægt (BMI 25-29,9) 01-01-1994
DE660B Fedme (BMI 30-34,9) 01-04-2003
DE660C Svær fedme (BMI 35-39,9) 01-04-2003
DE660D Ekstrem fedme, BMI 40+ 01-04-2003 31-03-2010
DE660E Ekstrem fedme, BMI 40-44.9 01-04-2010
DE660F Ekstrem fedme, BMI 45-49.9 01-04-2010
DE660G Ekstrem fedme, BMI 50-54.9 01-04-2010
DE660H Ekstrem fedme, BMI 55+ 01-04-2010
DE661 Fedme forårsaget af lægemiddel 01-01-1994
DE662 Ekstrem fedme med hypoventilation 01-01-1994
DE662A Pickwick's syndrom 01-01-1994 31-12-2011
DE668 Anden overvægt eller fedme 01-01-1994
DE669 Overvægt UNS 01-01-1994
DE67 Anden overernæring 01-01-1994
DE670 A-hypervitaminose 01-01-1994
DE671 Hyperkarotinæmi 01-01-1994
DE672 B6-hypervitaminose 01-01-1994
DE673 D-hypervitaminose 01-01-1994
DE678 Anden overernæring 01-01-1994
DE68 Følger af overernæring 01-01-1994
DE689 Følger af overernæring UNS 01-01-1994
DE70 Forstyrrelser i omsætningen af aromatiske aminosyrer 01-01-1994
DE700 Klassisk fenylketonuri 01-01-1994
DE701 Hyperfenylalaninæmi 01-01-1994
DE702 Forstyrrelser i tyrosinomsætningen 01-01-1994
DE702A Alkaptonuri 01-01-1994
DE702B Hypertyrosinæmi 01-01-1994
DE703 Albinisme 01-01-1994
DE703A Okulær albinisme 01-01-1994
DE703B Okulokutan albinisme 01-01-1994
DE703C Syndroma Chediak-Steinbrinck-Higashi 01-01-1994 31-12-2011
DE703D Syndroma Cross 01-01-1994 31-12-2011
DE703E Syndroma Hermansky-Pudlak 01-01-1994 31-12-2011
DE703F Piebaldisme 01-04-2000
DE708 Anden forstyrrelse i omsætningen af aromatiske aminosyrer 01-01-1994
DE708A Forstyrrelse i tryptofanomsætningen 01-01-2012
DE708B Forstyrrelse i histidinomsætningen 01-01-2012
DE709 Forstyrrelser i omsætningen af aromatiske aminosyrer UNS 01-01-1994
DE71 Forstyrr. i omsætn. af forgrenede aminosyrer og fedtsyrer 01-01-1994
DE710 Ahornsirup-urin-sygdom (MSUD) 01-01-1994
DE711 Anden forstyrrelse i omsætningen af forgrenede aminosyrer 01-01-1994
DE711A Hyperleucin-isoleucinæmi 01-01-1994
DE711B Hypervalinæmi 01-01-1994
DE711C Isovalerinacidæmi 01-01-1994
DE711D Metylmalonacidæmi 01-01-1994
DE711E Propionacidæmi 01-01-1994
DE712 Forstyrrelse i omsætningen af forgrenede aminosyrer UNS 01-01-1994
DE713 Forstyrrelse i fedtomsætningen 01-01-1994
DE713A Adrenoleukodystrofi (Addison-Schilder) 01-01-1994
DE713B Muskel-karnitinpalmityltransferasemangel 01-01-1994
DE713C Acyl-CoA dehydrogenasemangel 01-01-2016
DE713C1 Kortkædet acyl-CoA dehydrogenasemangel (SCADD) 01-01-2016
DE713C2 Mellemkædet Acyl-CoA dehydrogenasemangel (MCADD) 01-01-2016
DE713C3 Langkædet 3-OH-acyl-CoA dehydrogenasemangel (LCHADD) 01-01-2016
DE713C4 Meget langkædet acyl-CoA dehydrogenasemangel (VLCADD) 01-01-2016
DE72 Andre forstyrrelser i aminosyreomsætningen 01-01-1994
DE720 Forstyrrelse i aminosyretransporten 01-01-1994
DE720A Cystinose 01-01-1994
DE720B Cystinuri 01-01-1994
DE720C Fanconis syndrom 01-01-1994
DE720D Hartnups sygdom 01-01-1994
DE720E Lowes syndrom 01-01-2012
DE721 Forstyrrelse i omsætningen af svovlholdige aminosyrer 01-01-1994
DE721A Cystationinuri 01-01-1994
DE721B Homocystinuri 01-01-1994
DE721C Metioninæmi 01-01-1994
DE721D Sulfitoxidasemangel 01-01-1994
DE721E Methylentetrahydrofolat reduktase defekt 01-04-2019
DE722 Forstyrrelse i urinstofcyklus 01-01-1994
DE722A Argininæmi 01-01-1994
DE722B Arginosuccinaciduri 01-01-1994
DE722C Citrullinæmi 01-01-1994
DE722D Hyperammonæmi 01-01-1994
DE723 Forstyrrelse i lysin og hydroxylysinomsætningen 01-01-1994
DE723A Glutaraciduri 01-01-1994
DE723B Hydroxylysinæmi 01-01-1994
DE723C Hyperlysinæmi 01-01-1994
DE724 Forstyrrelse i ornitinomsætningen 01-01-1994
DE724A Ornithinaemia type I, II 01-01-1994 31-12-2011
DE725 Forstyrrelser i glycinomsætningen 01-01-1994
DE725A Nonketotisk hyperglycinæmi 01-01-1994
DE725B Hyperhydroxyprolinæmi 01-01-1994
DE725C Hyperprolinæmi type I og II 01-01-1994
DE725D Sarkosinæmi 01-01-1994
DE728 Anden forstyrrelse i aminosyreomsætningen 01-01-1994
DE728A Forstyrrelse i beta-aminosyreomsætningen 01-01-1994
DE728B Forstyrrelse i gamma-glutamylcyklus 01-01-1994
DE728C Disordo metabolicus histidini 01-01-1994 31-12-2011
DE728D Disordo metabolicus tryptophani 01-01-1994 31-12-2011
DE728E Prolidasemangel 01-04-2000
DE728F 2,8-dihydroxyadenuri 01-01-2002
DE729 Forstyrrelse i aminosyreomsætningen UNS 01-01-1994
DE73 Laktoseintolerans 01-01-1994
DE730 Medfødt laktasemangel 01-01-1994
DE730A Laktasemangel, medfødt 01-01-1994 31-12-2011
DE730B Laktoseintolerans, medfødt 01-01-1994 31-12-2011
DE731 Erhvervet laktasemangel 01-01-1994
DE731A Laktasemangel, erhvervet 01-01-1994 31-12-2011
DE731B Laktoseintolerans, erhvervet 01-01-1994 31-12-2011
DE738 Anden laktoseintolerans 01-01-1994
DE738A Laktosemalabsorption 01-10-2004
DE739 Laktoseintolerans UNS 01-01-1994
DE74 Andre forstyrrelser i kulhydratomsætningen 01-01-1994
DE740 Forstyrrelse i glykogenaflejringen 01-01-1994
DE740A Glykogenose type IV 01-01-1994
DE740B Glykogenose type III 01-01-1994
DE740C Leverfosforylase-mangel 01-01-1994
DE740D Forbes' sygdom 01-01-1994 31-12-2011
DE740E Hjerteglykogenose 01-01-1994
DE740F Glykogenose type VI 01-01-1994
DE740G Glykogenose type V 01-01-1994
DE740H Glykogenose type II 01-01-1994
DE740I Glykogenose type VII 01-01-1994
DE740J Glykogenose type I 01-01-1994
DE741 Forstyrrelse i fruktoseomsætningen 01-01-1994
DE741A Deficientia fructose-1,6-diphosphatasis 01-01-1994 31-12-2011
DE741B Fruktose-1,6-difosfatasemangel 01-01-1994
DE741C Essentiel fruktosuri 01-01-1994
DE741D Medfødt fruktoseintolerance 01-01-1994
DE742 Forstyrrelse i galaktoseomsætningen 01-01-1994
DE742A Galaktokinasemangel 01-01-1994
DE742B Galaktosæmi 01-01-1994
DE743 Anden forstyrrelse i optagelsen af kulhydrat i tarmen 01-01-1994
DE743A Sukrasemangel 01-01-1994
DE743B Glukose-galaktosemalabsorption 01-01-1994
DE744 Forstyrrelse i pyruvatomsætningen og glukoneogenesen 01-01-1994
DE744A Fosfoenol-pyruvatkarboxykinasemangel 01-01-1994
DE744B Pyruvatdehydrogenasemangel 01-01-1994
DE744C Pyruvatkarboxylasemangel 01-01-1994
DE748 Anden forstyrrelse i kulhydratomsætningen 01-01-1994
DE748A Renal glukosuri 01-01-1994
DE748B Oxalose 01-01-1994
DE748C Hyperoxaluri UNS 01-01-1994
DE748D Essentiel pentosuri 01-01-1994
DE748E Enterisk hyperoxaluri 01-01-2002
DE748G Idiopatisk hyperoxaluri 01-10-2012
DE749 Forstyrrelse i kulhydratomsætningen UNS 01-01-1994
DE75 Forstyrr. i sfingolipidomsætn/an. lipidaflejringsforstyrr 01-01-1994
DE750 GM2-gangliosidose 01-01-1994
DE750A GM2-gangliosidose hos voksen 01-01-1994
DE750B GM2-gangliosidose hos barn UNS 01-01-1994
DE750C Sandhoffs sygdom (type2) 01-01-1994
DE750D Tay-Sachs' sygdom 01-01-1994
DE751 Anden gangliosidose 01-01-1994
DE751A Gangliosidose UNS 01-01-1994
DE751B GM1-gangliosidose 01-01-1994
DE751C GM3-gangliosidose 01-01-1994
DE751D Mukolipidose IV 01-01-1994
DE752 Anden sfingolipidose 01-01-1994
DE752A Farbers syndrom 01-01-1994
DE752B Fabrys sygdom 01-01-1994
DE752C Gauchers sygdom 01-01-1994
DE752D Krabbes sygdom 01-01-1994
DE752E Metakromatisk leukodystrofi 01-01-1994
DE752F Lipidosis cerebrosidea 01-01-1994
DE752G Lipidosis sphingomyelinea 01-01-1994
DE752H Niemann-Picks sygdom 01-01-1994
DE753 Sfingolipidose UNS 01-01-1994
DE754 Neuronal ceroid lipofuskinose 01-01-1994
DE754A Batten's sygdom 01-01-1994 31-12-2011
DE754B Neuronal ceroid lipofuskinose type 2 01-01-1994
DE754C Neuronal ceroid lipofuskinose type 4 01-01-1994
DE754D Lipofuscinosis neuronalis 01-01-1994 31-12-2011
DE754E Neuronal ceroid lipofuskinose type 3 01-01-1994
DE754F Neuronal ceroid lipofuskinose type 1 01-01-2012
DE755 Anden lipidaflejringssygdom 01-01-1994
DE755A Cholesterosis cerebrotendinosa 01-01-1994
DE755B Wolmans sygdom 01-01-1994
DE756 Lipidaflejringssygdom UNS 01-01-1994
DE76 Forstyrrelser i glukosaminoglykanomsætningen 01-01-1994
DE760 Mukopolysakkaridose type I 01-01-1994
DE760A Hurler-Scheie's syndrom 01-01-1994
DE760B Hurlers syndrom 01-01-2012
DE760C Scheie's syndrom 01-01-2012
DE761 Mukopolysakkaridose type II 01-01-1994
DE761A Hunter's syndrom 01-01-1994 31-12-2011
DE762 Anden mukopolysakkaridose 01-01-1994
DE762A Beta-glukuronidasemangel 01-01-1994
DE762B Mukopolysakkaridose type VI 01-01-1994
DE762C Mukopolysakkaridose type IV 01-01-1994
DE762D Mucopolysaccharidosis, type III, IV, VI, VII 01-01-1994 31-12-2011
DE762E Mukopolysakkaridose type III 01-01-1994
DE762G Mukopolysakkaridose type VII 01-01-2012
DE762H Mukopolysakkaridose type IX 01-01-2012
DE763 Mukopolysakkaridose UNS 01-01-1994
DE768 Anden forstyrrelse i glukosaminoglykanomsætningen 01-01-1994
DE769 Forstyrrelse i glukosaminoglykanomsætningen UNS 01-01-1994
DE77 Forstyrrelser i glykoproteinomsætningen 01-01-1994
DE770 Posttranslational defekt i lysosomale enzymer 01-01-1994
DE770A Mukolipidose II 01-01-1994
DE770B Mukolipidose III 01-01-1994
DE771 Defekt i glykoproteinnedbrydningen 01-01-1994
DE771A Aspartylglukosaminuri 01-01-1994
DE771B Fukosidose 01-01-1994
DE771C Mannosidose 01-01-1994
DE771D Mukolipidose I 01-01-1994
DE771E Sialidosis 01-01-1994 31-12-2011
DE778 Anden forstyrrelse i glykoproteinomsætningen 01-01-1994
DE779 Forstyrrelse i glykoproteinomsætningen UNS 01-01-1994
DE78 Forstyrrelser i lipoproteinomsætningen og andre lipidæmier 01-01-1994
DE780 Hyperkolesterolæmi 01-01-1994
DE780A Hyperbetalipoproteinæmi 01-01-1994
DE780B Familiær hyperkolesterolæmi 01-01-1994
DE780B1 Familiær hyperkolesterolæmi, heterozygot 01-01-2016
DE780B2 Familiær hyperkolesterolæmi, homozygot 01-01-2016
DE780C Hyperlipidæmi gruppe A 01-01-1994
DE780D Fredrickson type IIa-hyperlipoproteinæmi 01-01-1994
DE780E Low-density-lipoprotein hyperlipoproteinæmi 01-01-1994
DE780F Müller-Harbitz's sygdom 01-01-1994 31-12-2011
DE781 Hyperglyceridæmi 01-01-1994
DE781A Endogen hyperglyceridæmi 01-01-1994
DE781B Hyperlipidæmi gruppe B 01-01-1994
DE781C Fredrickson type IV hyperlipoproteinæmi 01-01-1994
DE781D Very-low-density-lipoprotein hyperlipoproteinæmi 01-01-1994
DE781E Hyperpræbetalipoproteinæmi 01-01-1994
DE782 Blandet hyperlipidæmi 01-01-1994
DE782A Betalipoproteinæmi 01-01-1994
DE782B Hyperbetalipoproteinæmi med præbetalipoproteinæmi 01-01-1994
DE782C Hyperkolesterolæmi med endogen hyperglyceridæmi 01-01-1994
DE782D Hyperlipidæmi gruppe C 01-01-1994
DE782E Fredrickson type IIb/III hyperlipoproteinæmi 01-01-1994
DE782F Xanthoma tuberosum 01-01-1994
DE782G Xanthoma tubo-eruptivum 01-01-1994
DE782H Xanthoma planum 01-04-2000
DE782I Xanthoma tubo-eruptivum 01-04-2000 31-12-2011
DE782J Xanthomatose 01-04-2000
DE783 Hyperkylomikronæmi 01-01-1994
DE783A Hyperglyceridæmi, blandingsform 01-01-1994
DE783B Hyperlipidæmi gruppe D 01-01-1994
DE783C Fredrickson, type I/V hyperlipoproteinæmi 01-01-1994
DE784 Anden hyperlipidæmi 01-01-1994
DE784A Familiær kombineret hyperlipidæmi 01-01-2012
DE785 Hyperlipidæmi UNS 01-01-1994
DE786 Lipoproteinmangel 01-01-1994
DE786A Aalfalipoproteinæmi 01-01-1994
DE786B Abetalipoproteinæmi 01-01-1994
DE786C High-density-lipoprotein-mangel 01-01-1994
DE786D Hypoalphalipoproteinaemia 01-01-1994 31-12-2011
DE786E Hypobetalipoproteinæmi 01-01-1994
DE786F Lecitin-kolesterol-acyltransferase-mangel 01-01-1994
DE786G Tangier's sygdom 01-01-1994 31-12-2011
DE788 Anden forstyrrelse i lipoproteinomsætningen 01-01-1994
DE788A Subkutan lipogranulomatose 01-04-2000
DE788B Hyalinose i hud eller slimhinde 01-04-2000
DE789 Forstyrrelse i lipoproteinomsætningen UNS 01-01-1994
DE79 Forstyrrelser i purin- eller pyrimidinomsætningen 01-01-1994
DE790 Asymptomatisk hyperurikæmi 01-01-1994
DE791 Lesch-Nyhans syndrom 01-01-1994
DE798 Anden forstyrrelse i purin- eller pyrimidinomsætningen 01-01-1994
DE798A Arvelig xantinuri 01-01-1994
DE798B Uratsten med hyperurikæmi 01-01-2002
DE798C Uratsten uden hyperurikæmi 01-01-2002
DE799 Forstyrrelse i purin- eller pyrimidinomsætningen UNS 01-01-1994
DE80 Forstyrrelser i porfyrin- eller bilirubinomsætningen 01-01-1994
DE800 Familiær erytropoietisk porfyri 01-01-1994
DE801 Porphyria cutanea tarda 01-01-1994
DE802 Anden form for porfyri 01-01-1994
DE802A Hereditær koproporfyri 01-01-1994
DE802B Intermitterende porfyri 01-01-1994
DE802C Porphyria hepatica 01-01-1994
DE802D Porfyri UNS 01-01-1994
DE802E Porphyria variegata 01-04-2000
DE802F Porphyria e dialysis 01-04-2000
DE802G Porphyria hepatoerythropoietica 01-04-2000
DE803 Katalase- eller peroxidasedefekt 01-01-1994
DE803A Akatalasæmi 01-01-1994
DE803B Forstyrrelse af peroxidaseomsætningen 01-01-1994
DE803C Takahara's sygdom 01-01-1994 31-12-2011
DE804 Hyperbilirubinæmi type 1 01-01-1994
DE804A Icterus non haemolyticus congenitus familiaris 01-01-1994
DE805 Crigler-Najjars sygdom 01-01-1994
DE806 Anden forstyrrelse i bilirubinomsætningen 01-01-1994
DE806A Hyperbilirubinæmi type 2 01-01-1994
DE806B Rotors syndrom 01-01-1994
DE807 Forstyrrelse i bilirubinomsætningen UNS 01-01-1994
DE83 Forstyrrelser i mineralomsætningen 01-01-1994
DE830 Forstyrrelser i kobberomsætningen 01-01-1994
DE830A Menkes' syndrom 01-01-1994
DE830B Wilsons sygdom 01-01-1994
DE831 Forstyrrelser i jernomsætningen 01-01-1994
DE831A Hæmokromatose 01-01-1994
DE832 Forstyrrelser i zinkomsætningen 01-01-1994
DE832A Acrodermatitis enteropathica 01-01-1994
DE833 Forstyrrelser i fosforomsætningen og fosfataser 01-01-1994
DE833A Hypofosfatæmi 01-01-1994
DE833A1 Familiær hypofosfatæmi 01-01-2012
DE833B D-vitaminresistent rakitis 01-01-1994
DE834 Forstyrrelse i magnesiumomsætningen 01-01-1994
DE834A Hypermagnesiæmi 01-01-1994
DE834B Hypomagnesiæmi 01-01-1994
DE835 Forstyrrelser i kalciumomsætningen 01-01-1994
DE835A Familiær hypokalcurisk hyperkalcæmi 01-01-1994
DE835B Idiopatisk hyperkalciuri 01-01-1994
DE835C Hyperkalcæmi UNS 01-01-2001
DE835D Hypokalcæmi UNS 01-01-2001
DE838 Anden forstyrrelse i mineralomsætningen 01-01-1994
DE839 Forstyrrelse i mineralomsætningen UNS 01-01-1994
DE84 Cystisk fibrose 01-01-1994
DE840 Cystisk fibrose med lungemanifestationer 01-01-1994
DE841 Cystisk fibrose med tarmmanifestationer 01-01-1994
DE848 Cystisk fibrose med anden manifestation 01-01-1994
DE848A Cystisk fibrose m kombinerede manifestationer 01-01-2012 31-12-2012
DE849 Cystisk fibrose UNS 01-01-1994
DE85 Amyloidose 01-01-1994
DE850 Arvelig amyloidose uden neurologiske symptomer 01-01-1994
DE850A Familiær middelhavsfeber 01-01-1994
DE851 Arvelig nerveamyloidose 01-01-1994
DE851A Amyloidose med polyneuropati 01-01-1994
DE852 Arvelig amyloidose UNS 01-01-1994
DE853 Sekundær systemisk amyloidose 01-01-1994
DE853A Amyloidosis generalisata secundaria 01-01-1994 31-12-2011
DE853B Amyloidosis ved hæmodialyse 01-01-1994
DE854 Lokaliseret amyloidose 01-01-1994
DE858 Anden amyloidose 01-01-1994
DE858A AL amyloidose 01-07-2018
DE859 Amyloidose UNS 01-01-1994
DE86 Udtørring og nedsat ekstracellulærvolumen 01-01-1994
DE869 Volumennedsættelse af plasma eller ekstracellulær væske 01-01-1994
DE869A Dehydrering 01-01-1994
DE869B Hypovolæmi uden shock 01-01-1994
DE87 An. forstyrr. i vand-, elektrolyt- og syre-basebalance 01-01-1994
DE870 Hyperosmolalitet eller hypernatriæmi 01-01-1994
DE870A Hypernatriæmi 01-01-1994
DE870B Hyperosmolalitet 01-01-1994
DE871 Hypoosmolalitet eller hyponatriæmi 01-01-1994
DE871A Hyponatriæmi 01-01-1994
DE871B Hypoosmolalitet 01-01-1994
DE872 Acidose 01-01-1994
DE872A Laktacidose 01-01-1994
DE872B Metabolisk acidose 01-01-1994
DE872C Respiratorisk acidose 01-01-1994
DE872D Acidosis uden specifikation 01-01-1994 31-12-2011
DE873 Alkalose 01-01-1994
DE873A Metabolisk alkalose 01-01-1994
DE873B Respiratorisk alkalose 01-01-1994
DE873C Alkalosis uden specifikation 01-01-1994 31-12-2011
DE874 Blandet forstyrrelse i syre-basebalancen 01-01-1994
DE875 Hyperkaliæmi 01-01-1994
DE875A Hyperkaliæmi 01-10-2003 31-12-2011
DE876 Hypokaliæmi 01-01-1994
DE876A Hypokaliæmi 01-10-2003 31-12-2011
DE877 Væskeoverskud 01-01-1994
DE877A Væskeretention 01-01-1994
DE878 Forstyrrelse i vand- eller elektrolytbalancen IKA 01-01-1994
DE878A Hyperkloræmi 01-01-1994
DE878B Hypokloræmi 01-01-1994
DE878C Idiopatisk hypocitraturi 01-01-2002
DE88 Andre metaboliske forstyrrelser 01-01-1994
DE880 Forstyrrelse i plasmaproteinomsætningen IKA 01-01-1994
DE880A Alfa-1-antitrypsinmangel 01-01-1994
DE880B Alfa-1-proteinaseinhibitormangel 01-01-1994
DE880C Bisalbuminæmi 01-01-1994
DE881 Lipodystrofi IKA 01-01-1994
DE881A Lipodystrofi UNS 01-01-1994
DE882 Lipomatose IKA 01-01-1994
DE882A Lipomatosis dolorosa Dercum 01-01-1994
DE882B Lipomatose UNS 01-01-2012
DE883 Tumor lysis-syndrom 01-01-2012
DE888 Anden metabolisk forstyrrelse 01-01-1994
DE888A Adenolipomatosum subcutis colli 01-01-1994
DE888B Trimetylaminuri 01-01-1994
DE888C Metabolisk syndrom 01-07-2006
DE888D Plasmakolinesterasemangel 01-01-2007
DE889 Omsætningsforstyrrelse UNS 01-01-1994
DE89 Endokrine forstyrr. og omsætningsforstyrrelser eft beh. IKA 01-01-1994
DE890 Myksødem efter behandling 01-01-1994
DE890A Myksødem efter strålebehandling 01-01-1994
DE890B Myksødem efter operation 01-01-2012
DE891 Hypoinsulinæmi efter operation 01-01-1994
DE891A Hyperglykæmi efter pankreatektomi 01-01-1994
DE891B Hyperglycaemia efter pankreatektomi 01-01-1994 31-12-2011
DE891C Hypoinsulinæmi efter pankreatektomi 01-01-1994
DE892 Hypoparathyroidisme efter behandling 01-01-1994
DE892A Hypoparathyroidisme efter operation 01-01-1994
DE892B Hypoparathyroidisme efter strålebehandling 01-01-1994
DE893 Hypopituitarisme efter behandling 01-01-1994
DE893A Hypopituitarisme efter strålebehandling 01-01-1994
DE893B Hypopituitarisme efter operation 01-01-2012
DE894 Hypogonadisme efter behandling af ovarier 01-01-1994
DE894A Hypogonadisme efter strålebehandling af ovarier 01-01-1994
DE894B Hypogonadisme efter operation på ovarier 01-01-2012
DE895 Hypogonadisme efter behandling af testikler 01-01-1994
DE895A Hypogonadisme efter strålebehandling af testikler 01-01-1994
DE895B Hypogonadisme efter operation på testikler 01-01-2012
DE896 Nedsat produktion af binyrehormon efter behandling 01-01-1994
DE898 Anden endokrin forstyrrelse/omsætningsforstyrrelse eft. beh. 01-01-1994
DE899 Endokrin forstyrrelse/omsætningsforstyrrelse eft. beh. UNS 01-01-1994
DE90 Forstyrr i ernæring og stofskifte ved sygdom klass ansted 01-01-1994 31-12-2011
DE909 Forstyrr i ernæring og stofskifte ved sygd klass ansted 01-01-1994 31-12-2011
DF00 Demens ved Alzheimers sygdom 01-01-1994
DF000 Demens ved Alzheimers sygdom med tidlig debut 01-01-1994
DF0000 Demens ved tidlig Alzheimers sygdom uden andre symptomer 01-01-1995
DF0001 Demens ved tidlig Alzheimers sygdom med paranoide symptomer 01-01-1994
DF0002 Demens ved tidlig Alzheimers sygdom med hallucinationer 01-01-1994
DF0003 Demens ved tidlig Alzheimers sygdom med depressive symptomer 01-01-1994
DF0004 Demens ved tidlig Alzheimers sygdom med blandede symptomer 01-01-1994
DF001 Demens ved Alzheimers sygdom med sen debut 01-01-1994
DF0010 Demens ved sen Alzheimers sygdom uden andre symptomer 01-01-1995
DF0011 Demens ved sen Alzheimers sygdom med paranoide symptomer 01-01-1994
DF0012 Demens ved sen Alzheimers sygdom med hallucinationer 01-01-1994
DF0013 Demens ved sen Alzheimers sygdom med depressive symptomer 01-01-1994
DF0014 Demens ved sen Alzheimers sygdom med blandede symptomer 01-01-1994
DF002 Demens ved Alzheimers sygdom af atypisk eller blandet type 01-01-1994
DF0020 Demens ved atypisk Alzheimers sygdom uden andre symptomer 01-01-1995
DF0021 Demens ved atypisk Alzheimers sygdom med paranoide symptomer 01-01-1994
DF0022 Demens ved atypisk Alzheimers sygdom med hallucinationer 01-01-1994
DF0023 Demens ved atypisk Alzheimers sygdom m. depressive symptomer 01-01-1994
DF0024 Demens ved atypisk Alzheimers sygdom med blandede symptomer 01-01-1994
DF009 Demens ved Alzheimers sygdom UNS 01-01-1994
DF0090 Demens uden andre symptomer ved Alzheimers sygdom UNS 01-01-1995
DF0091 Demens med paranoide symptomer ved Alzheimers sygdom UNS 01-01-1994
DF0092 Demens med hallucinationer ved Alzheimers sygdom UNS 01-01-1994
DF0093 Demens med depressive symptomer ved Alzheimers sygdom UNS 01-01-1994
DF0094 Demens med blandede symptomer ved Alzheimers sygdom UNS 01-01-1994
DF01 Vaskulær demens 01-01-1994
DF010 Vaskulær demens med akut indsætten 01-01-1994
DF0100 Vaskulær demens med akut indsætten uden andre symptomer 01-01-1995
DF0101 Vaskulær demens med akut indsætten med paranoide symptomer 01-01-1994
DF0102 Vaskulær demens med akut indsætten med hallucinationer 01-01-1994
DF0103 Vaskulær demens med akut indsætten med depressive symptomer 01-01-1994
DF0104 Vaskulær demens med akut indsætten med blandede symptomer 01-01-1994
DF011 Multiinfarktdemens 01-01-1994
DF0110 Multiinfarktdemens uden andre symptomer 01-01-1995
DF0111 Multiinfarktdemens med paranoide symptomer 01-01-1994
DF0112 Multiinfarktdemens med hallucinationer 01-01-1994
DF0113 Multiinfarktdemens med depressive symptomer 01-01-1994
DF0114 Multiinfarktdemens med blandede symptomer 01-01-1994
DF012 Subkortikal vaskulær demens 01-01-1994
DF0120 Subkortikal vaskulær demens uden andre symptomer 01-01-1995
DF0121 Subkortikal vaskulær demens med paranoide symptomer 01-01-1994
DF0122 Subkortikal vaskulær demens med hallucinationer 01-01-1994
DF0123 Subkortikal vaskulær demens med depressive symptomer 01-01-1994
DF0124 Subkortikal vaskulær demens med blandede symptomer 01-01-1994
DF013 Blandet kortikal og subkortikal vaskulær demens 01-01-1994
DF0130 Bl. kortikal og subkortikal vaskulær demens u. an. sympt. 01-01-1995
DF0131 Bl. kortikal og subkortikal vaskulær demens m paranoide symp 01-01-1994
DF0132 Bl. kortikal og subkortikal vaskulær demens m. hallucination 01-01-1994
DF0133 Bl. kortikal og subkortikal vaskulær demens m depress. sympt 01-01-1994
DF0134 Bl. kortikal og subkortikal vaskulær demens m. bl. sympt. 01-01-1994
DF018 Anden vaskulær demens 01-01-1994
DF0180 Anden vaskulær demens uden andre symptomer 01-01-1995
DF0181 Anden vaskulær demens med paranoide symptomer 01-01-1994
DF0182 Anden vaskulær demens med hallucinationer 01-01-1994
DF0183 Anden vaskulær demens med depressive symptomer 01-01-1994
DF0184 Anden vaskulær demens med blandede symptomer 01-01-1994
DF019 Vaskulær demens UNS 01-01-1994
DF0190 Vaskulær demens uden andre symptomer UNS 01-01-1995
DF0191 Vaskulær demens med paranoide symptomer UNS 01-01-1994
DF0192 Vaskulær demens med hallucinationer UNS 01-01-1994
DF0193 Vaskulær demens med depressive symptomer UNS 01-01-1994
DF0194 Vaskulær demens med blandede symptomer UNS 01-01-1994
DF02 Demens ved andre sygdomme klassificeret andetsteds 01-01-1994
DF020 Demens ved Picks sygdom 01-01-1994
DF0200 Demens ved Picks sygdom uden andre symptomer 01-01-1995
DF0201 Demens ved Picks sygdom med paranoide symptomer 01-01-1994
DF0202 Demens ved Picks sygdom med hallucinationer 01-01-1994
DF0203 Demens ved Picks sygdom med depressive symptomer 01-01-1994
DF0204 Demens ved Picks sygdom med blandede symptomer 01-01-1994
DF021 Demens ved Creutzfeldt-Jakobs sygdom 01-01-1994
DF0210 Demens ved Creutzfeldt-Jakobs sygdom uden andre symptomer 01-01-1995
DF0211 Demens ved Creutzfeldt-Jakobs sygdom med paranoide symptomer 01-01-1994
DF0212 Demens ved Creutzfeldt-Jakobs sygdom med hallucinationer 01-01-1994
DF0213 Demens ved Creutzfeldt-Jakobs sygdom m. depressive symptomer 01-01-1994
DF0214 Demens ved Creutzfeldt-Jakobs sygdom med blandede symptomer 01-01-1994
DF022 Demens ved Huntingtons sygdom 01-01-1994
DF0220 Demens ved Huntingtons sygdom uden andre symptomer 01-01-1995
DF0221 Demens ved Huntingtons sygdom med paranoide symptomer 01-01-1994
DF0222 Demens ved Huntingtons sygdom med hallucinationer 01-01-1994
DF0223 Demens ved Huntingtons sygdom med depressive symptomer 01-01-1994
DF0224 Demens ved Huntingtons sygdom med blandede symptomer 01-01-1994
DF023 Demens ved Parkinsons sygdom 01-01-1994
DF0230 Demens ved Parkinsons sygdom uden andre symptomer 01-01-1995
DF0231 Demens ved Parkinsons sygdom med paranoide symptomer 01-01-1994
DF0232 Demens ved Parkinsons sygdom med hallucinationer 01-01-1994
DF0233 Demens ved Parkinsons sygdom med depressive symptomer 01-01-1994
DF0234 Demens ved Parkinsons sygdom med blandede symptomer 01-01-1994
DF024 Demens ved HIV-sygdom 01-01-1994
DF0240 Demens ved HIV-sygdom uden andre symptomer 01-01-1995
DF0241 Demens ved HIV-sygdom med paranoide symptomer 01-01-1994
DF0242 Demens ved HIV-sygdom med hallucinationer 01-01-1994
DF0243 Demens ved HIV-sygdom med depressive symptomer 01-01-1994
DF0244 Demens ved HIV-sygdom med blandede symptomer 01-01-1994
DF028 Demens ved anden sygdom klassificeret andetsteds 01-01-1994
DF0280 Demens uden andre symptomer ved anden sygdom 01-01-1995
DF0281 Demens med paranoide symptomer ved anden sygdom 01-01-1994
DF0282 Demens med hallucinationer ved anden sygdom 01-01-1994
DF0283 Demens med depressive symptomer ved anden sygdom 01-01-1994
DF0284 Demens med blandede symptomer ved anden sygdom 01-01-1994
DF03 Ikke specificeret demens 01-01-1994
DF039 Demens UNS 01-01-1994
DF0390 Demens uden andre symptomer UNS 01-01-1995
DF0391 Demens med paranoide symptomer UNS 01-01-1994
DF0392 Demens med hallucinationer UNS 01-01-1994
DF0393 Demens med depressive symptomer UNS 01-01-1994
DF0394 Demens med blandede symptomer UNS 01-01-1994
DF04 Organisk amnestisk syndr. ej f.a. alkohol/psykoakt. Stoffer 01-01-1994
DF049 Organisk amnestisk syndrom, ikke prov. af psykoak.stof 01-01-1994
DF05 Delir, ikke fremkaldt af alkohol eller psykoaktive stoffer 01-01-1994
DF050 Delir uden demens 01-01-1994
DF051 Delir ved demens 01-01-1994
DF058 Andet delir 01-01-1994
DF059 Delir UNS 01-01-1994
DF06 An. psykisk lid. sfa hjerneskade, dysfunktion, legemlig sygd 01-01-1994
DF060 Organisk hallucinose 01-01-1994
DF061 Organisk kataton sindslidelse 01-01-1994
DF062 Organisk paranoid eller skizofreniform sindslidelse 01-01-1994
DF063 Organisk affektiv sindslidelse 01-01-1994
DF0630 Organisk manisk sindslidelse 01-01-1995
DF0631 Organisk bipolar affektiv sindslidelse 01-01-1994
DF0632 Organisk depressiv sindslidelse 01-01-1994
DF0633 Organisk affektiv blandingstilstand 01-01-1994
DF064 Organisk angsttilstand 01-01-1994
DF065 Organisk dissociativ tilstand 01-01-1994
DF066 Organisk emotionel instabilitet og asteni 01-01-1994
DF067 Organisk kognitiv forstyrrelse af lettere grad 01-01-1994
DF0670 Organisk kognitiv forstyrr, let grad ikke assoc.m som. sygd 01-01-1995
DF0671 Organisk kognitiv forstyrr, let grad assoc.m som. sygd 01-01-1994
DF068 Anden organisk psykisk lidelse 01-01-1994
DF069 Organisk psykisk lidelse UNS 01-01-1994
DF07 Personligh./adfærdsforst. f.a. sygd., hjernebeskad./dysfunk. 01-01-1994
DF070 Organisk personlighedsforstyrrelse 01-01-1994
DF071 Postencefalitisk syndrom 01-01-1994
DF072 Posttraumatisk hjernesyndrom 01-01-1994
DF078 Anden organisk personligheds- eller adfærdsforstyrrelse 01-01-1994
DF079 Organisk personligheds- eller adfærdsforstyrrelse UNS 01-01-1994
DF09 Ikke spec. organisk/sympt.mental lidelse/personligh.forstyrr 01-01-1994
DF099 Organisk/sympt. mental lidelse/personlighedsforstyrr UNS 01-01-1994
DF10 Psyk. lidel. og adfærdsmæssige forstyr. f.a. brug af alkohol 01-01-1994
DF100 Akut alkoholintoksikation 01-01-1994
DF1000 Akut ukompliceret alkoholintoksikation 01-01-1995
DF1001 Akut alkoholintoksikation med fysisk traume 01-01-1994
DF1002 Akut alkoholintoksikation med andre somatiske komplikationer 01-01-1994
DF1003 Akut alkoholintoksikation med delir 01-01-1994
DF1004 Akut alkoholintoksikation med perceptionsforvrængninger 01-01-1994
DF1005 Akut alkoholintoksikation med koma 01-01-1994
DF1006 Akut alkoholintoksikation med kramper 01-01-1994
DF1007 Akut alkoholintoksikation med patologisk rus 01-01-1994
DF101 Skadelig brug af alkohol 01-01-1994
DF102 Alkoholafhængighedssyndrom 01-01-1994
DF1020 Alkoholafhængighedssyndrom, afholdende 01-01-1995
DF1021 Alkoholafhængighedssyndrom, afholdende i beskyttet miljø 01-01-1994
DF1022 Alkoholafhængighedssyndrom i vedligehold/subst-beh 01-01-1994
DF1023 Alkoholafhængighedssyndrom, afholdende, aversiv med-beh 01-01-1994
DF1024 Alkoholafhængighedssyndrom, aktivt brugende 01-01-1994
DF1025 Alkoholafhængighedssyndrom med kontinuerligt brug 01-01-1994
DF1026 Alkoholafhængighedssyndrom, episodisk brug 01-01-1994
DF103 Abstinenstilstand sfa alkoholbrug 01-01-1994
DF1030 Abstinenstilstand sfa alkoholbrug uden kramper 01-01-1995
DF1031 Abstinenstilstand forårsaget af alkoholbrug med kramper 01-01-1994
DF104 Delirøs abstinenstilstand sfa alkoholbrug 01-01-1994
DF1040 Delirøs abstinenstilstand sfa alkoholbrug u kramper 01-01-1995
DF1041 Delirøs abstinenstilstand f.a. alkoholbrug med kramper 01-01-1994
DF105 Alkoholpsykose 01-01-1994
DF1050 Skizofrenilignende alkoholpsykose 01-01-1995
DF1051 Paranoid alkoholpsykose 01-01-1994
DF1052 Hallucinatorisk alkoholpsykose 01-01-1994
DF1053 Polymorf alkoholpsykose 01-01-1994
DF1054 Alkoholpsykose med depressive symptomer 01-01-1994
DF1055 Alkoholpsykose med maniske symptomer 01-01-1994
DF1056 Alkoholpsykose med blandede symptomer 01-01-1994
DF106 Amnestisk syndrom sfa alkoholbrug 01-01-1994
DF107 Sen psykotisk eller residual tilstand f.a. alkoholbrug 01-01-1994
DF1070 Flashbacks som følge af alkoholbrug 01-01-1995
DF1071 Personligheds- eller adfærdsforstyrrelse f.a. alkoholbrug 01-01-1994
DF1072 Residual affektiv sindslidelse sfa alkoholbrug 01-01-1994
DF1073 Demens sfa alkoholbrug 01-01-1994
DF1074 An. vedvarende kognitiv forstyrr. sfa alkoholbrug 01-01-1994
DF1075 Sent indsættende psykotisk tilstand sfa alkoholbrug 01-01-1994
DF108 Anden psykisk lidelse/adfærdsforstyrrelse f.a. alkoholbrug 01-01-1994
DF109 Psykisk lidelse el. adfærdsforstyrrelse f.a. alkoholbrug UNS 01-01-1994
DF11 Psykiske lidelser og adfærdsmæssige forstyr. f.a. opioider 01-01-1994
DF110 Akut opioidintoksikation 01-01-1994
DF1100 Akut ukompliceret opioidintoksikation 01-01-1995
DF1101 Akut opioidintoksikation med fysisk traume 01-01-1994
DF1102 Akut opioidintoksikation med andre somatiske komplikationer 01-01-1994
DF1103 Akut opioidintoksikation med delir 01-01-1994
DF1104 Akut opioidintoksikation med perceptionsforvrængninger 01-01-1994
DF1105 Akut opioidintoksikation med koma 01-01-1994
DF1106 Akut opioidintoksikation med kramper 01-01-1994
DF111 Skadelig brug af opioider 01-01-1994
DF112 Opioidafhængighedssyndrom 01-01-1994
DF1120 Opioidafhængighedssyndrom, afholdende 01-01-1995
DF1121 Opioidafhængighedssyndrom, afholdende i beskyttet miljø 01-01-1994
DF1122 Opioidafhængighedssyndrom i vedligehold/subst-beh 01-01-1994
DF1123 Opioidafhængighedssyndrom, afholdende, aversiv med-beh 01-01-1994
DF1124 Opioidafhængighedssyndrom, aktivt brugende 01-01-1994
DF1125 Opioidafhængighedssyndrom med kontinuerligt brug 01-01-1994
DF1126 Opioidafhængighedssyndrom, episodisk brug 01-01-1994
DF113 Abstinenstilstand sfa opioidbrug 01-01-1994
DF1130 Abstinenstilstand sfa opioidbrug uden kramper 01-01-1995
DF1131 Abstinenstilstand forårsaget af opioidbrug med kramper 01-01-1994
DF114 Delirøs abstinenstilstand sfa opioidbrug 01-01-1994
DF1140 Delirøs abstinenstilstand sfa opioidbrug u kramper 01-01-1995
DF1141 Delirøs abstinenstilstand f.a. opioidbrug med kramper 01-01-1994
DF115 Opioidpsykose 01-01-1994
DF1150 Skizofrenilignende opioidpsykose 01-01-1995
DF1151 Paranoid opioidpsykose 01-01-1994
DF1152 Hallucinatorisk opioidpsykose 01-01-1994
DF1153 Polymorf opioidpsykose 01-01-1994
DF1154 Opioidpsykose med depressive symptomer 01-01-1994
DF1155 Opioidpsykose med maniske symptomer 01-01-1994
DF1156 Opioidpsykose med blandede symptomer 01-01-1994
DF117 Sen psykotisk el. residual tilstand forårsaget af opioidbrug 01-01-1994
DF1170 Flashbacks som følge af opioidbrug 01-01-1995
DF1171 Personligheds- eller adfærdsforstyrrelse f.a. opioidbrug 01-01-1994
DF1172 Residual affektiv sindslidelse sfa opioidbrug 01-01-1994
DF1173 Demens sfa opioidbrug 01-01-1994
DF1174 An. vedvarende kognitiv forstyrr. sfa opioidbrug 01-01-1994
DF1175 Sent indsættende psykotisk tilstand sfa opioidbrug 01-01-1994
DF118 Anden psykisk lidelse/adfærdsforstyrrelse f.a. opioidbrug 01-01-1994
DF119 Psykisk lidelse el. adfærdsforstyrrelse f.a. opioidbrug UNS 01-01-1994
DF12 Psykiske lidelser og adfærdsmæssige forstyr. f.a. cannabis 01-01-1994
DF120 Akut cannabisintoksikation 01-01-1994
DF1200 Akut ukompliceret cannabisintoksikation 01-01-1995
DF1201 Akut cannabisintoksikation med fysisk traume 01-01-1994
DF1202 Akut cannabisintoksikation m. andre somatiske komplikationer 01-01-1994
DF1203 Akut cannabisintoksikation med delir 01-01-1994
DF1204 Akut cannabisintoksikation med perceptionsforvrængninger 01-01-1994
DF1205 Akut cannabisintoksikation med koma 01-01-1994
DF1206 Akut cannabisintoksikation med kramper 01-01-1994
DF121 Skadelig brug af cannabis 01-01-1994
DF122 Cannabisafhængighedssyndrom 01-01-1994
DF1220 Cannabisafhængighedssyndrom, afholdende 01-01-1995
DF1221 Cannabisafhængighedssyndrom, afholdende i beskyttet miljø 01-01-1994
DF1222 Cannabisafhængighedssyndrom i vedligehold/subst-beh 01-01-1994
DF1223 Cannabisafhængighedssyndrom, afholdende, aversiv med-beh 01-01-1994
DF1224 Cannabisafhængighedssyndrom, aktivt brugende 01-01-1994
DF1225 Cannabisafhængighedssyndrom med kontinuerligt brug 01-01-1994
DF1226 Cannabisafhængighedssyndrom, episodisk brug 01-01-1994
DF125 Cannabispsykose 01-01-1994
DF1250 Skizofrenilignende cannabispsykose 01-01-1995
DF1251 Paranoid cannabispsykose 01-01-1994
DF1252 Hallucinatorisk cannabispsykose 01-01-1994
DF1253 Polymorf cannabispsykose 01-01-1994
DF1254 Cannabispsykose med depressive symptomer 01-01-1994
DF1255 Cannabispsykose med maniske symptomer 01-01-1994
DF1256 Cannabispsykose med blandede symptomer 01-01-1994
DF127 Sen psykotisk el. residual tilstand f.a. cannabisbrug 01-01-1994
DF1270 Flashbacks sfa cannabisbrug 01-01-1995
DF1271 Personligheds- eller adfærdsforstyrrelse f.a. cannabisbrug 01-01-1994
DF1272 Residual affektiv sindslidelse sfa cannabisbrug 01-01-1994
DF1273 Demens sfa cannabisbrug 01-01-1994
DF1274 An. vedvarende kognitiv forstyrrelse sfa cannabisbrug 01-01-1994
DF1275 Sent indsættende psykotisk tilst. sfa cannabisbrug 01-01-1994
DF128 An. psykisk lidelse/adfærdsforstyrrelse f.a. cannabisbrug 01-01-1994
DF129 Psykisk lidelse/adfærdsforstyrrelse f.a. cannabisbrug UNS 01-01-1994
DF13 Psyk. lidelser og adfærds. forstyr. f.a. sedativa/hypnotika 01-01-1994
DF130 Akut intoksikation med sedativa eller hypnotika 01-01-1994
DF1300 Akut ukompliceret intoksikation med sedativa eller hypnotika 01-01-1995
DF1301 Akut intoks. med sedativa eller hypnotika med fysisk traume 01-01-1994
DF1302 Akut intoks. m. sedativa/hypnotika m. andre somatiske kompl. 01-01-1994
DF1303 Akut intoksikation med sedativa eller hypnotika med delir 01-01-1994
DF1304 Akut intox. m. sedativa/hypnotika m. perceptionsforvrængning 01-01-1994
DF1305 Akut intoksikation med sedativa eller hypnotika med koma 01-01-1994
DF1306 Akut intoksikation med sedativa eller hypnotika med kramper 01-01-1994
DF131 Skadelig brug af sedativa/hypnotika 01-01-1994
DF132 Afhængighedssyndrom ved brug af sedativa eller hypnotika 01-01-1994
DF1320 Afhængighedssynd. ved brug af sedativa/hypnotika, afholdende 01-01-1995
DF1321 Afhæng-syndr. sedativa/hypnotika, afholdende i beskyt.miljø 01-01-1994
DF1322 Afhæng-syndr. sedativa/hypnotika i vedligeh/subst-beh 01-01-1994
DF1323 Afhæng-syndr. sedativ/hypnotika, afholdende, aversiv med-beh 01-01-1994
DF1324 Afhængighedssynd. ved sedativa/hypnotika brug, aktiv bruger 01-01-1994
DF1325 Afhængighedssyndrom v sedativa/hypnotika, kontinuerligt brug 01-01-1994
DF1326 Afhængighedssyndrom ved sedativa/hypnotika, episodisk brug 01-01-1994
DF133 Abstinenstilstand sfa sedativa/hypnotika 01-01-1994
DF1330 Abstinenstilstand sfa sedativa/hypnotika u kramper 01-01-1995
DF1331 Abstinenstilstand f.a. brug af sedativa/hypnotika m. krampe 01-01-1994
DF134 Delirøs abstinenstilstand sfa sedativa/hypnotika 01-01-1994
DF1340 Delirøs abstinenstilstand sfa sedativa/hypnotika u kramper 01-01-1995
DF1341 Delirøs abstinenstilstand f.a. sedativa/hypnotika m. kramper 01-01-1994
DF135 Psykotisk tilstand ved brug af sedativa eller hypnotika 01-01-1994
DF1350 Skizofrenilignende psykot. tilst. sfa sedativa/hypnotika 01-01-1995
DF1351 Paranoid psykotisk tilst. sfa sedativa/hypnotika 01-01-1994
DF1352 Hallucinatorisk psykotisk tilst. sfa sedativa/hypnotika 01-01-1994
DF1353 Polymorf psykot. tilst. sfa sedativa/hypnotika 01-01-1994
DF1354 Psykot. tilst. m. depres. sympt. ved sedativa/hypnotika brug 01-01-1994
DF1355 Psykot. Tilst. m. maniske sympt. v. brug af sedativa/hypnot. 01-01-1994
DF1356 Blandet psykotisk tilst. sfa sedativa/hypnotika 01-01-1994
DF137 Sen psykotisk/residual tilst. sfa sedativa/hypnotika 01-01-1994
DF1370 Flashbacks sfa sedativa/hypnotika 01-01-1995
DF1371 Personligheds-/adfærdsforstyrrelse sfa sedativa/hypnotika 01-01-1994
DF1372 Residual affektiv sindslidelse sfa sedativa/hypnotika 01-01-1994
DF1373 Demens sfa sedativa/hypnotika 01-01-1994
DF1374 An. vedvarende kognitiv forstyrrelse sfa sedativa/hypnotika 01-01-1994
DF1375 Sent indsættende psykotisk tilstand sfa sedativa/hypnotika 01-01-1994
DF138 An. psykisk lidelse/adfærdsforstyrr. sfa sedativa/hypnotika 01-01-1994
DF139 Psykisk lidelse/adfærdsforstyrr. sfa sedativa/hypnotika UNS 01-01-1994
DF14 Psykiske lidelser og adfærdsforstyrrelser f.a. kokain 01-01-1994
DF140 Akut kokainintoksikation 01-01-1994
DF1400 Akut ukompliceret kokainintoksikation 01-01-1995
DF1401 Akut kokainintoksikation med fysisk traume 01-01-1994
DF1402 Akut kokainintoksikation med andre somatiske komplikationer 01-01-1994
DF1403 Akut kokainintoksikation med delirøs tilstand 01-01-1994
DF1404 Akut kokainintoksikation med perceptionsforvrængninger 01-01-1994
DF1405 Akut kokainintoksikation med koma 01-01-1994
DF1406 Akut kokainintoksikation med kramper 01-01-1994
DF141 Skadelig brug af kokain 01-01-1994
DF142 Afhængighedssyndrom ved brug af kokain 01-01-1994
DF1420 Afhængighedssyndrom ved brug af kokain men afholdende 01-01-1995
DF1421 Afhængighedssyndrom ved kokain, afholdende i beskyttet miljø 01-01-1994
DF1422 Afhængighedssyndrom v. kokain i vedligehold/subst-behandling 01-01-1994
DF1423 Afhængighedssyndrom v. kokain, afholdende, aversiv med.-beh. 01-01-1994
DF1424 Afhængighedssyndrom ved brug af kokain aktivt brugende 01-01-1994
DF1425 Afhængighedssyndrom v. brug af kokain med kontinuerligt brug 01-01-1994
DF1426 Afhængighedssyndrom ved brug af kokain med episodisk brug 01-01-1994
DF143 Abstinenstilstand sfa kokain 01-01-2000
DF1430 Abstinenstilstand sfa kokain uden kramper 01-01-2000
DF1431 Abstinenstilstand forårsaget af brug af kokain med kramper 01-01-2000
DF145 Kokainpsykose 01-01-1994
DF1450 Skizofrenilignende kokainpsykose 01-01-1995
DF1451 Paranoid kokainpsykose 01-01-1994
DF1452 Hallucinatorisk kokainpsykose 01-01-1994
DF1453 Polymorf kokainpsykose 01-01-1994
DF1454 Kokainpsykose med depressive symptomer 01-01-1994
DF1455 Kokainpsykose med maniske symptomer 01-01-1994
DF1456 Kokainpsykose med blandede symptomer 01-01-1994
DF147 Sen psykotisk el. residual tilstand forårsaget af kokainbrug 01-01-1994
DF1470 Flashbacks sfa kokainbrug 01-01-1995
DF1471 Personligheds- eller adfærdsforstyrrelse f.a. kokainbrug 01-01-1994
DF1472 Residual affektiv sindslidelse sfa kokainbrug 01-01-1994
DF1473 Demens sfa kokainbrug 01-01-1994
DF1474 An. vedvarende kognitiv forstyrrelse sfa kokainbrug 01-01-1994
DF1475 Sent indsættende psykotisk tilstand sfa kokainbrug 01-01-1994
DF148 Anden psykisk lidelse/adfærdsforstyrrelse f.a. kokainbrug 01-01-1994
DF149 Psykisk lidelse el. adfærdsforstyrrelse f.a. kokainbrug UNS 01-01-1994
DF15 Psykiske lidelser/adfærdsforstyr. f.a. an. centralstim. stof 01-01-1994
DF150 Akut intoksikation med andet centralstimulerende stof 01-01-1994
DF1500 Akut ukompliceret intoksikation med andet centralstim. stof 01-01-1995
DF1501 Akut intoksikation m. an. centralstim. stof m. fysisk traume 01-01-1994
DF1502 Akut intox. m. an. centralstim. stof m. an. somatiske kompl. 01-01-1994
DF1503 Akut intoksikation med andet centralstim. stof med delir 01-01-1994
DF1504 Akut intox. m an. centralstim.stof m perceptionsforvrængning 01-01-1994
DF1505 Akut intoksikation med andet centralstim. stof med koma 01-01-1994
DF1506 Akut intoksikation med andet centralstim. stof med kramper 01-01-1994
DF151 Skadelig brug af andet centralstimulerende stof 01-01-1994
DF152 Afhængighedssyndrom ved brug af andet centralstim. stof 01-01-1994
DF1520 Afhængighedssyndrom ved an. centralstimul.stof, afholdende 01-01-1995
DF1521 Afhæng-syndr. v an. centralstim.stof, afhold/beskyttet miljø 01-01-1994
DF1522 Afhæng-syndr. v an. centralstim. stof, vedligeh./subst.-beh. 01-01-1994
DF1523 Afhæng-syndr. v an. centralstim.stof, afhold/aversiv med-beh 01-01-1994
DF1524 Afhængighedssyndrom v. an. centralstim.stof, aktivt brugende 01-01-1994
DF1525 Afhængighedssyndrom v an. centralstim.stof, kontinuerl. brug 01-01-1994
DF1526 Afhængighedssyndrom v. an. centralstim. stof, episodisk brug 01-01-1994
DF153 Abstinenstilstand f.a. brug af an. centralstimulerende stof 01-01-1999
DF1530 Abstinenstilstand f.a. an. centralstim. stoffer u. kramper 01-01-1999
DF1531 Abstinenstilstand f.a. an. centralstim. stoffer med kramper 01-01-1999
DF155 Psykotisk tilstand v. brug af andet centralstimulerende stof 01-01-1994
DF1550 Skizofrenilignende psykot. tilst, an.centralstim.stof 01-01-1995
DF1551 Paranoid psykotisk tilstand v. brug af an. centralstim. stof 01-01-1994
DF1552 Hallucinat. psykot. tilst. v. brug af an. centralstim. stof 01-01-1994
DF1553 Polymorf psykotisk tilstand v. brug af an. centralstim. stof 01-01-1994
DF1554 Psykotisk tilst. med depres. sympt., an. centralstim. stof 01-01-1994
DF1555 Psykot. tilstand m. maniske sympt. v. an. centralstim. stof 01-01-1994
DF1556 Blandet psykotisk tilstand ved brug af an. centralstim. stof 01-01-1994
DF157 Sen psykotisk/residual tilstand f.a. an. centralstim. stof 01-01-1994
DF1570 Flashbacks f.a. brug af andet centralstimulerende stof 01-01-1995
DF1571 Personligh.-/adf-forstyr. f.a. brug af an. centralstim. stof 01-01-1994
DF1572 Residual affektiv sindslidelse f.a. an. centralstim. stof 01-01-1994
DF1573 Demens forårsaget af brug af andet centralstimulerende stof 01-01-1994
DF1574 An. vedvarende kognitiv forstyrr. f.a. an. centralstim. stof 01-01-1994
DF1575 Sent indsættende psykotisk tilst. f.a. an. centralstim. stof 01-01-1994
DF158 An. psykisk lidelse/adfærdsforst. f.a. an. centralstim. stof 01-01-1994
DF159 Psykisk lidelse/adfærdsforst. f.a. an. centralstim. stof UNS 01-01-1994
DF16 Psykiske lidelser og adfærdsmæ. forstyr. f.a. hallucinogener 01-01-1994
DF160 Akut hallucinogenintoksikation 01-01-1994
DF1600 Akut ukompliceret hallucinogenintoksikation 01-01-1995
DF1601 Akut hallucinogenintoksikation med fysisk traume 01-01-1994
DF1602 Akut hallucinogenintoksikation med andre somatiske kompl. 01-01-1994
DF1603 Akut hallucinogenintoksikation med delir 01-01-1994
DF1604 Akut hallucinogenintoksikation med perceptionsforvrængninger 01-01-1994
DF1605 Akut hallucinogenintoksikation med koma 01-01-1994
DF1606 Akut hallucinogenintoksikation med kramper 01-01-1994
DF161 Skadelig brug af hallucinogen 01-01-1994
DF162 Afhængighedssyndrom ved brug af hallucinogen 01-01-1994
DF1620 Afhængighedssyndrom ved brug af hallucinogen men afholdende 01-01-1995
DF1621 Afhæng-syndr. sfa hallucinogen, afholdende, beskyttet miljø 01-01-1994
DF1622 Afhæng-syndr. sfa hallucinogen, vedligeh/subst-beh 01-01-1994
DF1623 Afhæng-syndr. sfa hallucinogen, afholdende, aversiv med-beh 01-01-1994
DF1624 Afhængighedssyndrom ved brug af hallucinogen aktivt brugende 01-01-1994
DF1625 Afhængighedssyndrom ved brug af hallucinogen m. kont. Brug 01-01-1994
DF1626 Afhængighedssynd. ved brug af hallucinogen m. episodisk brug 01-01-1994
DF165 Hallucinogenpsykose 01-01-1994
DF1650 Skizofrenilignende hallucinogenpsykose 01-01-1995
DF1651 Paranoid hallucinogenpsykose 01-01-1994
DF1652 Hallucinatorisk hallucinogenpsykose 01-01-1994
DF1653 Polymorf hallucinogenpsykose 01-01-1994
DF1654 Hallucinogenpsykose med depressive symptomer 01-01-1994
DF1655 Hallucinogenpsykose med maniske symptomer 01-01-1994
DF1656 Hallucinogenpsykose med blandede symptomer 01-01-1994
DF167 Sen psykotisk/residual tilstand f.a. hallucinogenbrug 01-01-1994
DF1670 Flashbacks sfa hallucinogenbrug 01-01-1995
DF1671 Personligheds- el. adfærdsforstyrrelse f.a. hallucinogenbrug 01-01-1994
DF1672 Residual affektiv sindslidelse sfa hallucinogenbrug 01-01-1994
DF1673 Demens sfa hallucinogenbrug 01-01-1994
DF1674 An. vedvarende kognitiv forstyrrelse sfa hallucinogenbrug 01-01-1994
DF1675 Sent indsættende psykotisk tilstand sfa hallucinogenbrug 01-01-1994
DF168 Anden psykisk lidelse/adfærdsforstyr. f.a. hallucinogenbrug 01-01-1994
DF169 Psykisk lidelse/adfærdsforstyr. f.a. hallucinogenbrug UNS 01-01-1994
DF17 Psykiske lidelser og adfærdsmæssige forstyr. f.a. tobak 01-01-1994
DF170 Akut tobaksintoksikation 01-01-1994
DF1700 Akut ukompliceret tobaksintoksikation 01-01-1995
DF1701 Akut tobaksintoksikation med fysisk traume 01-01-1994
DF1702 Akut tobaksintoksikation med andre somatiske komplikationer 01-01-1994
DF1703 Akut tobaksintoksikation med delir 01-01-1994
DF1704 Akut tobaksintoksikation med perceptionsforvrængninger 01-01-1994
DF1705 Akut tobaksintoksikation med koma 01-01-1994
DF1706 Akut tobaksintoksikation med kramper 01-01-1994
DF171 Skadelig brug af tobak 01-01-1994
DF172 Afhængighedssyndrom ved brug af tobak 01-01-1994
DF1720 Afhængighedssyndrom ved brug af tobak men afholdende 01-01-1995
DF1721 Afhængighedssyndrom ved tobak, afholdende i beskyttet miljø 01-01-1994
DF1722 Afhængighedssyndrom v. brug af tobak i vedl.-/subst-behandl. 01-01-1994
DF1723 Afhængighedssyndrom v. tobak, afholdende, aversiv med.-beh. 01-01-1994
DF1724 Afhængighedssyndrom ved brug af tobak aktivt brugende 01-01-1994
DF1725 Afhængighedssyndrom ved brug af tobak med kontinuerligt brug 01-01-1994
DF1726 Afhængighedssyndrom ved brug af tobak med episodisk brug 01-01-1994
DF178 Anden psykisk lidelse/adfærdsforstyrrelse f.a. tobaksbrug 01-01-1994
DF179 Psykisk lidelse el. adfærdsforstyrrelse f.a. tobaksbrug UNS 01-01-1994
DF18 Psykiske lidelser og adfærdsforstyr. f.a. flygtige opløs-mid 01-01-1994
DF180 Akut intoksikation med flygtigt opløsningsmiddel 01-01-1994
DF1800 Akut ukompliceret intoksikation m. flygtige opløsningsmidler 01-01-1995
DF1801 Akut intoksikation m. flygtige opløs-midl. m. fysisk traume 01-01-1994
DF1802 Akut intoks. m. flygtige opløs-midl. m. an. somatiske kompl. 01-01-1994
DF1803 Akut intoksikation med flygtige opløsningsmidler med delir 01-01-1994
DF1804 Akut intoks. m flygtigt opløs-mid. m perceptionsforvrængning 01-01-1994
DF1805 Akut intoksikation med flygtige opløsningsmidler med koma 01-01-1994
DF1806 Akut intoksikation med flygtige opløsningsmidler med kramper 01-01-1994
DF181 Skadelig brug af flygtigt opløsningsmiddel 01-01-1994
DF182 Afhængighedssyndrom ved brug af flygtigt opløsningsmiddel 01-01-1994
DF1820 Afhængighedssyndrom v. flygtige opløsningsmidler, afholdende 01-01-1995
DF1821 Afhæng-syndr. v flygtigt opløs.mid., afhold, beskyttet miljø 01-01-1994
DF1822 Afhængighedssyndr. v flygtigt opløs.mid, vedligeh/subst-beh. 01-01-1994
DF1823 Afhæng-syndr. v flygtigt opløs.mid, afhold, aversiv med-beh. 01-01-1994
DF1824 Afhængighedssyndrom ved flygtige opløs.-midl., aktiv bruger 01-01-1994
DF1825 Afhængighedssyndr. v flygtigt opløs.mid., kontinuerligt brug 01-01-1994
DF1826 Afhængighedssyndrom v. flygtigt opløs.-midl., episodisk brug 01-01-1994
DF185 Psykotisk tilstand ved brug af flygtige opløsningsmidler 01-01-1994
DF1850 Skizofrenilignende psykotisk tilst. v. flygtigt opløs-middel 01-01-1995
DF1851 Paranoid psykotisk tilstand v. brug af flygtige opløs-midl. 01-01-1994
DF1852 Hallucinatorisk psykotisk tilst. v flygtigt opløsningsmiddel 01-01-1994
DF1853 Polymorf psykotisk tilstand ved brug af flygtige opløs-midl. 01-01-1994
DF1854 Psykotisk tilst. m. depres. sympt. v. flygtigt opløsningsmid 01-01-1994
DF1855 Psykotisk tilst. m manisk sympt. v flygtigt opløsningsmiddel 01-01-1994
DF1856 Blandet psykotisk tilstand ved brug af flygtige opløs.-midl. 01-01-1994
DF186 Amnestisk syndrom sfa flygtigt opløsningsmiddel 01-01-1994
DF187 Sen psykotisk/residual tilst. f.a. flygtigt opløsningsmid. 01-01-1994
DF1870 Flashbacks sfa flygtigt opløsningsmiddel 01-01-1995
DF1871 Personligheds- el adfærdsforstyrrelse sfa flygtigt opløs-mid 01-01-1994
DF1872 Residual affektiv sindslidelse sfa flygtigt opløsningsmiddel 01-01-1994
DF1873 Demens sfa flygtigt opløsningsmiddel 01-01-1994
DF1874 An. vedvarende kognitiv forstyrrelse sfa flygtigt opløs-mid 01-01-1994
DF1875 Sent indsættende psykotisk tilstand sfa flygtigt opløs-mid 01-01-1994
DF188 An. psykisk lidelse/adfærdsforstyr. f.a. flygtigt opløs-mid 01-01-1994
DF189 Psykisk lidelse/adfærdsforstyr. f.a. flygtigt opløs-mid UNS 01-01-1994
DF19 Psyk. lid./adfærdsforstyrr. f.a. mult./an. psykoaktivt stof 01-01-1994
DF190 Akut intoksikation m. multiple el. andre psykoaktive stoffer 01-01-1994
DF1900 Akut ukompliceret intoksikation m mult./an. psykoaktivt stof 01-01-1995
DF1901 Akut intoksikation m mult./an. psykoaktivt stof m fys.traume 01-01-1994
DF1902 Akut intoksikation m mult./an. psykoak.stof m an. som-kompl. 01-01-1994
DF1903 Akut intox. med fl. el. andre psykoaktive stoffer med delir 01-01-1994
DF1904 Akut intoksikation m mult/an.psykoak.stof m percept-forvræng 01-01-1994
DF1905 Akut intoksikation m. multiple/an. psykoaktivt stof m. koma 01-01-1994
DF1906 Akut intoksikation m. fl./an. psykoaktive stoffer m. kramper 01-01-1994
DF191 Skadelig brug af flere eller andre psykoaktive stoffer 01-01-1994
DF192 Afhængighedssyndrom v. brug af fl./andre psykoaktive stoffer 01-01-1994
DF1920 Afhængighedssyndrom v mult./an. psykoaktivt stof, afholdende 01-01-1995
DF1921 Afhæng-syndr v mult/an. psykoakt-stof, afhold i beskyt-miljø 01-01-1994
DF1922 Afhæng-syndr.v mult/an. psykoaktivt stof, vedligeh/subst-beh 01-01-1994
DF1923 Afhæng-syndr. v mult/an.psykoak.stof, afhold, avers. med-beh 01-01-1994
DF1924 Afhængighedssyndrom v mult/an. psykoak.stof, aktivt brugende 01-01-1994
DF1925 Afhængighedssyndrom v mult/an. psykoak.stof, kontinuerl.brug 01-01-1994
DF1926 Afhængighedssyndrom v mult./an. psykoak.stof, episodisk brug 01-01-1994
DF193 Abstinenstilstand sfa multiple/an. psykoaktivt stof 01-01-1994
DF1930 Abstinenstilstand sfa mult/an. psykoaktivt stof u kramper 01-01-1995
DF1931 Abstinenstilstand f.a. mult./an. psykoaktivt stof m. kramper 01-01-1994
DF194 Delirøs abstinenstilstand sfa multiple/an. psykoaktivt stof 01-01-1994
DF1940 Delirøs abstinenstilst v mult/an. psykoaktivt stof u kramper 01-01-1995
DF1941 Delirøs abstinenstilst v mult/an. psykoaktivt stof m kramper 01-01-1994
DF195 Psykotisk tilstand ved brug af fl./andre psykoaktive stoffer 01-01-1994
DF1950 Skizofrenilign. psykotisk tilst. v mult/an. psykoaktivt stof 01-01-1995
DF1951 Paranoid psykotisk tilst. v. multiple/an. psykoaktivt stof 01-01-1994
DF1952 Hallucinatorisk psykotisk tilst. v mult/an. psykoaktivt stof 01-01-1994
DF1953 Polymorf psykotisk tilst. v. multiple/an. psykoaktivt stof 01-01-1994
DF1954 Psykotisk tilst. m depres-sympt. v mult/an. psykoaktivt stof 01-01-1994
DF1955 Psykot. tilst. m. mani. sympt. v. mult./an. psykoaktivt stof 01-01-1994
DF1956 Bl. psykotisk tilst. ved brug af fl./an. psykoaktive stoffer 01-01-1994
DF196 Amnestisk syndrom sfa multiple/an. psykoaktivt stof 01-01-1994
DF197 Sen psykotisk/residual tilst. f.a. mult/an. psykoakt. stof 01-01-1994
DF1970 Flashbacks sfa multiple/an. psykoaktivt stof 01-01-1995
DF1971 Personligheds-/adfærdsforst. f.a. mult/an. psykoaktivt stof 01-01-1994
DF1972 Residual affektiv sindslidelse sfa mult/an. psykoaktivt stof 01-01-1994
DF1973 Demens sfa multiple/an. psykoaktivt stof 01-01-1994
DF1974 An. vedvarende kognitiv forstyr. sfa mult/an. psykoakt. stof 01-01-1994
DF1975 Sen psykotisk tilstand sfa multiple/an. psykoaktivt stof 01-01-1994
DF198 An. psykisk lid/adfærdsforst. sfa mult/an. psykoaktivt stof 01-01-1994
DF199 Psykisk lid/adfærdsforst. sfa mult/an. psykoaktivt stofUNS 01-01-1994
DF20 Skizofreni 01-01-1994
DF200 Paranoid skizofreni 01-01-1994
DF2000 Kontinuerlig paranoid skizofreni 01-01-1995
DF2001 Episodisk paranoid skizofreni med fremadskridende defekt 01-01-1994
DF2002 Episodisk paranoid skizofreni med stabil defekt 01-01-1994
DF2003 Episodisk remitterende paranoid skizofreni 01-01-1994
DF2004 Paranoid skizofreni med inkomplet remission 01-01-1994
DF2005 Paranoid skizofreni med komplet remission 01-01-1994
DF2008 Paranoid skizofreni med andet forløb 01-01-1994
DF2009 Paranoid skizofreni med ubestemt forløb 01-01-1994
DF201 Hebefren skizofreni 01-01-1994
DF2010 Kontinuerlig hebefren skizofreni 01-01-1995
DF2011 Episodisk hebefren skizofreni med fremadskridende defekt 01-01-1994
DF2012 Episodisk hebefren skizofreni med stabil defekt 01-01-1994
DF2013 Episodisk remitterende hebefren skizofreni 01-01-1994
DF2014 Hebefren skizofreni med inkomplet remission 01-01-1994
DF2015 Hebefren skizofreni med komplet remission 01-01-1994
DF2018 Hebefren skizofreni med andet forløb 01-01-1994
DF2019 Hebefren skizofreni med ubestemt forløb 01-01-1994
DF202 Kataton skizofreni 01-01-1994
DF2020 Kontinuerlig kataton skizofreni 01-01-1995
DF2021 Episodisk kataton skizofreni med fremadskridende defekt 01-01-1994
DF2022 Episodisk kataton skizofreni med stabil defekt 01-01-1994
DF2023 Episodisk remitterende kataton skizofreni 01-01-1994
DF2024 Kataton skizofreni med inkomplet remission 01-01-1994
DF2025 Kataton skizofreni med komplet remission 01-01-1994
DF2028 Kataton skizofreni med andet forløb 01-01-1994
DF2029 Kataton skizofreni med forløb ubestemt 01-01-1994
DF203 Udifferentieret skizofreni 01-01-1994
DF2030 Kontinuerlig udifferentieret skizofreni 01-01-1995
DF2031 Episodisk udiff. skizofreni med fremadskridende defekt 01-01-1994
DF2032 Episodisk udifferentieret skizofreni med stabil defekt 01-01-1994
DF2033 Episodisk remitterende udifferentieret skizofreni 01-01-1994
DF2034 Udifferentieret skizofreni med inkomplet remission 01-01-1994
DF2035 Udifferentieret skizofreni med komplet remission 01-01-1994
DF2038 Udifferentieret skizofreni med andet forløb 01-01-1994
DF2039 Udifferentieret skizofreni med ubestemt forløb 01-01-1994
DF204 Post-skizofren depression 01-01-1994
DF2040 Kontinuerlig post-skizofren depression 01-01-1995
DF2041 Episodisk post-skizofren depression m fremadskridende defekt 01-01-1994
DF2042 Episodisk post-skizofren depression med stabil defekt 01-01-1994
DF2043 Episodisk remitterende post-skizofren depression 01-01-1994
DF2044 Post-skizofren depression med inkomplet remission 01-01-1994
DF2045 Post-skizofren depression med komplet remission 01-01-1994
DF2048 Post-skizofren depression med andet forløb 01-01-1994
DF2049 Post-skizofren depression med ubestemt forløb 01-01-1994
DF205 Skizofren residual-tilstand 01-01-1994
DF2050 Kontinuerlig skizofren residualtilstand 01-01-1995
DF2051 Episodisk skizofren residualtilst. m. fremadskridende defekt 01-01-1994
DF2052 Episodisk skizofren residualtilstand med stabil defekt 01-01-1994
DF2053 Episodisk remitterende skizofren residualtilstand 01-01-1994
DF2054 Skizofren residualtilstand med inkomplet remission 01-01-1994
DF2055 Skizofren residualtilstand med komplet remission 01-01-1994
DF2058 Skizofren residualtilstand med andet forløb 01-01-1994
DF2059 Skizofren residualtilstand med ubestemt forløb 01-01-1994
DF206 Simpel skizofreni 01-01-1994
DF2060 Kontinuerlig simpel skizofreni 01-01-1995
DF2061 Episodisk simpel skizofreni med fremadskridende defekt 01-01-1994
DF2062 Episodisk simpel skizofreni med stabil defekt 01-01-1994
DF2063 Episodisk remitterende simpel skizofreni 01-01-1994
DF2064 Simpel skizofreni med inkomplet remission 01-01-1994
DF2065 Simpel skizofreni med komplet remission 01-01-1994
DF2068 Simpel skizofreni med andet forløb 01-01-1994
DF2069 Simpel skizofreni med ubestemt forløb 01-01-1994
DF208 Skizofreni af anden type 01-01-1994
DF2080 Kontinuerlig skizofreni af anden type 01-01-1995
DF2081 Episodisk skizofreni af anden type m. fremadskridende defekt 01-01-1994
DF2082 Episodisk skizofreni af anden type med stabil defekt 01-01-1994
DF2083 Episodisk remitterende skizofreni af anden type 01-01-1994
DF2084 Skizofreni af anden type med inkomplet remission 01-01-1994
DF2085 Skizofreni af anden type med komplet remission 01-01-1994
DF2088 Skizofreni af anden type med andet forløb 01-01-1994
DF2089 Skizofreni af anden type med ubestemt forløb 01-01-1994
DF209 Skizofreni UNS 01-01-1994
DF2090 Kontinuerlig skizofreni UNS 01-01-1995
DF2091 Episodisk skizofreni UNS med fremadskridende defekt 01-01-1994
DF2092 Episodisk skizofreni UNS med stabil defekt 01-01-1994
DF2093 Episodisk remitterende skizofreni UNS 01-01-1994
DF2094 Skizofreni UNS med inkomplet remission 01-01-1994
DF2095 Skizofreni UNS med komplet remission 01-01-1994
DF2098 Skizofreni UNS med andet forløb 01-01-1994
DF2099 Skizofreni UNS med ubestemt forløb 01-01-1994
DF21 Skizotypisk sindslidelse 01-01-1994
DF219 Skizotypisk sindslidelse UNS 01-01-1994
DF22 Paranoide psykoser 01-01-1994
DF220 Enkel paranoia 01-01-1994
DF228 Anden paranoid psykose 01-01-1994
DF229 Paranoid psykose UNS 01-01-1994
DF23 Akutte og forbigående psykoser 01-01-1994
DF230 Akut polymorf non-skizofreniform psykose 01-01-1994
DF2300 Akut polymorf non-skizofreniform non-reaktiv psykose 01-01-1995
DF2301 Akut polymorf non-skizofreniform reaktiv psykose 01-01-1994
DF231 Akut polymorf skizofreniform psykose 01-01-1994
DF2310 Akut polymorf skizofreniform non-reaktiv psykose 01-01-1995
DF2311 Akut polymorf skizofreniform reaktiv psykose 01-01-1994
DF232 Akut skizofreniform psykose 01-01-1994
DF2320 Akut skizofreniform non-reaktiv psykose 01-01-1995
DF2321 Akut skizofreniform reaktiv psykose 01-01-1994
DF233 Akut paranoid psykose 01-01-1994
DF2330 Akut paranoid non-reaktiv psykose 01-01-1995
DF2331 Akut paranoid reaktiv psykose 01-01-1994
DF238 Anden akut eller forbigående psykose 01-01-1994
DF2380 Anden non-reaktiv psykose 01-01-1995
DF2381 Anden reaktiv psykose 01-01-1994
DF239 Akut eller forbigående psykose UNS 01-01-1994
DF2390 Akut eller forbigående non-reaktiv psykose UNS 01-01-1995
DF2391 Akut eller forbigående reaktiv psykose UNS 01-01-1994
DF24 Induceret psykose 01-01-1994
DF249 Induceret paranoid psykose 01-01-1994
DF25 Skizoaffektive psykoser 01-01-1994
DF250 Skizoaffektiv psykose af manisk type 01-01-1994
DF2500 Skizoaffektiv manisk psykose med samtidige symptomer 01-01-1995
DF2501 Skizoaffektiv manisk psykose med varige skizofrene symptomer 01-01-1994
DF251 Skizoaffektiv psykose af depressiv type 01-01-1994
DF2510 Skizoaffektiv depressiv psykose med samtididige symptomer 01-01-1995
DF2511 Skizoaffektiv depressiv psykose med varige skizofrene sympt. 01-01-1994
DF252 Skizoaffektiv blandet manisk-depressiv psykose 01-01-1994
DF2520 Skizoaffektiv bland. man-depr. psykose m samtidige symptomer 01-01-1995
DF2521 Skizoaffektiv man-depr.psykose m varige skizofrene symptomer 01-01-1994
DF258 Skizoaffektiv psykose af anden type 01-01-1994
DF2580 Anden skizoaffektiv psykose med samtidige symptomer 01-01-1995
DF2581 Anden skizoaffektiv psykose med varige skizofrene symptomer 01-01-1994
DF259 Skizoaffektiv psykose UNS 01-01-1994
DF2590 Skizoaffektiv psykose UNS med samtidige symtomer 01-01-1995
DF2591 Skizoaffektiv psykose UNS med varige skizofrene symptomer 01-01-1994
DF28 Andre ikke-organiske psykoser 01-01-1994
DF289 Anden ikke-organisk psykose UNS 01-01-1994
DF29 Ikke spec. ikke-organisk psykose 01-01-1994
DF299 Ikke-organisk psykose UNS 01-01-1994
DF30 Manisk enkeltepisode 01-01-1994
DF300 Hypoman enkeltepisode 01-01-1994
DF301 Manisk enkeltepisode uden psykotiske symptomer 01-01-1994
DF302 Manisk enkeltepisode med psykotiske symptomer 01-01-1994
DF3020 Manisk enkeltepisode m. stemningskongr. psykotiske sympt. 01-01-1995
DF3021 Manisk enkeltepisode m. stemningsinkongruente psykot. sympt. 01-01-1994
DF308 Manisk enkeltepisode af anden type 01-01-1994
DF309 Manisk enkeltepisode UNS 01-01-1994
DF309A Mani UNS 01-01-2012
DF31 Bipolar affektiv sindslidelse 01-01-1994
DF310 Bipolar affektiv sindslidelse i hypoman episode 01-01-1994
DF311 Bip. aff. sindslid i manisk episode u psykot. sympt. 01-01-1994
DF312 Bipolar aff. sindslid. i manisk episode m. psykot. sympt. 01-01-1994
DF3120 Bip. aff. sindslid. i manisk epi. m stemn-kongr. psyko-sympt 01-01-1995
DF3121 Bip. aff. sindslid i manisk epi. m stemn.inkongr.psyko-sympt 01-01-1994
DF313 Bipolar affektiv sindslid. i lettere/moderat depressiv epi. 01-01-1994
DF3130 Bipolar depression lettere/moderat grad, non-melankoliform 01-01-1995 31-12-2011
DF3131 Bipolar depression af lettere/moderat grad, melankoliform 01-01-1994 31-12-2011
DF314 Bip. aff. sindslid i svær depress. episode u psykot. sympt. 01-01-1994
DF315 Bip. aff. sindslid i svær depres. episode m. psykot. sympt. 01-01-1994
DF3150 Bip. aff. sindslid, svær depres, stemn.kongr. psykot. sympt 01-01-1995
DF3151 Bip. aff. sindslid, svær depres, stemn.inkongr.psykot. sympt 01-01-1994
DF316 Bipolar affektiv sindslidelse i episode m. blandingstilstand 01-01-1994
DF317 Bipolar affektiv sindslidelse i remission 01-01-1994
DF318 Anden form for bipolar affektiv sindslidelse 01-01-1994
DF319 Bipolar affektiv sindslidelse UNS 01-01-1994
DF32 Depressiv enkeltepisode 01-01-1994
DF320 Depressiv enkeltepisode af lettere grad 01-01-1994
DF3200 Depressiv non-melankoliform enkeltepisode af lettere grad 01-01-1995
DF3201 Depressiv melankoliform enkeltepisode af lettere grad 01-01-1994
DF321 Depressiv enkeltepisode af moderat grad 01-01-1994
DF3210 Depressiv non-melankoliform enkeltepisode af moderat grad 01-01-1995
DF3211 Depressiv melankoliform enkeltepisode af moderat grad 01-01-1994
DF322 Depress. enkeltepisode af svær grad u psykot. sympt. 01-01-1994
DF323 Depressiv enkeltepisode af svær grad m. psykotiske symptomer 01-01-1994
DF3230 Depress. enkeltepisode, svær grad, stemn.kongr.psykot. sympt 01-01-1995
DF3231 Depress.enkeltepisode, svær grad, stemn.inkongr.psykot.sympt 01-01-1994
DF328 Depressiv enkeltepisode af anden type 01-01-1994
DF329 Depressiv enkeltepisode UNS 01-01-1994
DF329A Depressiv tilstand uden specifikation 01-04-2006 31-12-2011
DF33 Periodisk depression 01-01-1994
DF330 Periodisk depression i episode af lettere grad 01-01-1994
DF3300 Periodisk non-melankoliform depression i episode af let grad 01-01-1995
DF3301 Periodisk melankoliform depression i episode af let grad 01-01-1994
DF331 Periodisk depression i episode af moderat grad 01-01-1994
DF3310 Periodisk non-melankoliform depression, moderat grad 01-01-1995
DF3311 Periodisk melankoliform depression i episode af moderat grad 01-01-1994
DF332 Periodisk depression i episode af svær grad u psykot. sympt. 01-01-1994
DF333 Periodisk depression i episode af svær grad m psykot. sympt. 01-01-1994
DF3330 Periodisk depression, svær grad, stemningskongr.psykot.sympt 01-01-1995
DF3331 Periodisk depression, svær grad, stemn.inkongr. psykot.sympt 01-01-1994
DF334 Periodisk depression i remission 01-01-1994
DF338 Periodisk depression af anden type 01-01-1994
DF339 Periodisk depression UNS 01-01-1994
DF34 Vedvarende affektive tilstande 01-01-1994
DF340 Cyklotymi 01-01-1994
DF3400 Cyklotym personlighedsstruktur 01-01-1995
DF3401 Cyklotym tilstand 01-01-1994
DF341 Dystymi 01-01-1994
DF3410 Depressiv personlighedsstruktur 01-01-1995
DF3411 Kronisk lettere depressionstilstand 01-01-1994
DF348 Kronisk forstemningstilstand af anden type 01-01-1994
DF349 Kronisk forstemningstilstand UNS 01-01-1994
DF38 Andre affektive sindslidelser eller tilstande 01-01-1994
DF380 Anden affektiv sindslidelse, enkeltepisode 01-01-1994
DF3800 An. affektiv sindslidelse, enkeltepisode m. blandingstilst. 01-01-1995
DF381 Anden periodisk affektiv sindslidelse 01-01-1994
DF3810 Affektiv sindslid. m. tilbagevend., kortvarige depressioner 01-01-1995
DF388 Anden affektiv sindslidelse eller tilstand 01-01-1994
DF39 Ikke specificeret affektiv sindslidelse eller tilstand 01-01-1994
DF399 Affektiv sindslidelse UNS 01-01-1994
DF40 Fobiske angsttilstande 01-01-1994
DF400 Agorafobi 01-01-1994
DF4000 Agorafobi uden panikangst 01-01-1995
DF4001 Agorafobi med panikangst 01-01-1994
DF401 Socialfobi 01-01-1994
DF402 Enkelfobi 01-01-1994
DF402A Parasitofobi 01-04-2000
DF408 Fobisk angst af anden type 01-01-1994
DF408A Venerofobi 01-04-2000
DF409 Fobisk angst UNS 01-01-1994
DF41 Andre angsttilstande 01-01-1994
DF410 Panikangst 01-01-1994
DF4100 Moderat panikangst 01-01-1995
DF4101 Svær panikangst 01-01-1994
DF411 Generaliseret angst 01-01-1994
DF412 Lettere angst-depressionstilstand 01-01-1994
DF413 Anden blandet angsttilstand 01-01-1994
DF418 Anden angsttilstand 01-01-1994
DF418A Fødselsangst 01-01-2011
DF418B Angsthysteri 01-01-2012
DF419 Angsttilstand UNS 01-01-1994
DF42 Obsessiv-kompulsiv tilstand 01-01-1994
DF420 Overvejende obsessiv tilstand 01-01-1994
DF421 Overvejende kompulsiv tilstand 01-01-1994
DF422 Blandet obsessiv-kompulsiv tilstand 01-01-1994
DF428 Anden obsessiv-kompulsiv tilstand 01-01-1994
DF429 Obsessiv-kompulsiv tilstand UNS 01-01-1994
DF43 Reaktioner på svær belastning og tilpasningsreaktioner 01-01-1994
DF430 Akut belastningsreaktion 01-01-1994
DF4300 Let akut belastningsreaktion 01-01-1995
DF4301 Moderat akut belastningsreaktion 01-01-1994
DF4302 Svær akut belastningsreaktion 01-01-1994
DF431 Posttraumatisk belastningsreaktion 01-01-1994
DF432 Tilpasningsreaktion 01-01-1994
DF4320 Kortvarig depressiv tilpasningsreaktion 01-01-1995
DF4321 Langvarig depressiv tilpasningsreaktion 01-01-1994
DF4322 Blandet angst-depressiv tilpasningsreaktion 01-01-1994
DF4323 Tilpasningsreaktion med andre emotionelle symptomer 01-01-1994
DF4324 Tilpasningsreaktion med overvejende adfærdsforstyrrelse 01-01-1994
DF4325 Tilpasningsreaktion m adfærdssymptomer og emotionelle sympt. 01-01-1994
DF4328 Anden tilpasningsreaktion 01-01-1994
DF438 Anden belastningsreaktion 01-01-1994
DF439 Belastningsreaktion UNS 01-01-1994
DF44 Dissociative tilstande og forstyrrelser 01-01-1994
DF440 Dissociativ amnesi 01-01-1994
DF441 Dissociativ fugue 01-01-1994
DF442 Dissociativ stupor 01-01-1994
DF443 Dissociativ trance- eller besættelsestilstand 01-01-1994
DF444 Dissociativ bevægelsesforstyrrelse 01-01-1994
DF445 Dissociative kramper 01-01-1994
DF446 Dissociativ sanseforstyrrelse 01-01-1994
DF446A Psykogent høretab 01-01-2012
DF447 Blandet dissociativ tilstand 01-01-1994
DF448 Anden dissociativ tilstand eller forstyrrelse 01-01-1994
DF4480 Gansers syndrom 01-01-1995
DF4481 Multipel personlighed 01-01-1994
DF4482 Forbigående dissociativ tilstand i barndom eller adolescens 01-01-1994
DF4488 Anden dissociativ tilstand 01-01-1994
DF4488A Søvnrelateret dissociativ sygdom 01-04-2006
DF449 Dissociativ tilstand eller forstyrrelse UNS 01-01-1994
DF45 Somatoforme tilstande 01-01-1994
DF450 Somatiseringstilstand 01-01-1994
DF451 Udifferentieret somatoform tilstand 01-01-1994
DF452 Helbredsangst 01-01-1994
DF452A Dysmorfofobi 01-04-2000
DF453 Somatoform autonom dysfunktion 01-01-1994
DF4530 Somatoform autonom dysfunktion i det kardiovaskulære system 01-01-1995
DF4531 Somatoform autonom dysfunkt. i øvre gastrointestinale system 01-01-1994
DF4532 Somatoform autonom dysfunkt. i nedre gastrointestinale syst 01-01-1994
DF4533 Somatoform autonom dysfunktion i det respiratoriske system 01-01-1994
DF4534 Somatoform autonom dysfunktion i det urogenitale system 01-01-1994
DF4538 Somatoform autonom dysfunktion i andet organ eller system 01-01-1994
DF454 Vedvarende somatoform smertetilstand 01-01-1994
DF458 Anden somatoform tilstand 01-01-1994
DF459 Somatoform tilstand UNS 01-01-1994
DF48 Andre nervøse tilstande 01-01-1994
DF480 Neurasteni 01-01-1994
DF481 Depersonalisations-derealisations syndrom 01-01-1994
DF488 Anden nervøs tilstand 01-01-1994
DF489 Nervøs tilstand UNS 01-01-1994
DF50 Spiseforstyrrelser 01-01-1994
DF500 Nervøs spisevægring 01-01-1994
DF501 Atypisk nervøs spisevægring 01-01-1994
DF502 Nervøs spiseanfaldstilbøjelighed 01-01-1994
DF503 Atypisk nervøs spiseanfaldstilbøjelighed 01-01-1994
DF504 Trøstespisning 01-01-1994
DF505 Opkastning forbundet med anden psykisk forstyrrelse 01-01-1994
DF508 Anden spiseforstyrrelse 01-01-1994
DF508A Tvangsoverspisning (BED) 01-01-2021
DF509 Spiseforstyrrelse UNS 01-01-1994
DF51 Ikke-organiske søvnforstyrrelser 01-01-1994
DF510 Ikke-organisk søvnløshed 01-01-1994
DF5100 Søvnløshed UNS 01-04-2006
DF5101 Akut søvnløshed 01-04-2006
DF5102 Paradoks søvnløshed 01-04-2006
DF5103 Psykofysiologisk søvnløshed 01-04-2006
DF5104 Idiopatisk søvnløshed 01-04-2006
DF5105 Søvnløshed betinget af mental sygdom 01-04-2006
DF511 Ikke-organisk øget søvntrang 01-01-1994
DF5110 Hypersomni uden kendt årsag 01-04-2006
DF5111 Adfærdsbetinget utilstrækkelig søvn 01-04-2006
DF512 Ikke-organisk søvnrytmeforstyrrelse 01-01-1994
DF5120 Forstyrret søvnrytme UNS 01-04-2006
DF5121 Forstyrret søvnrytme pga tidszoneskift 01-04-2006
DF5122 Forstyrret søvnrytme pga skifteholdsarbejde 01-04-2006
DF5123 Forstyrret søvnrytme pga forsinket søvntid 01-04-2006
DF513 Søvngængeri 01-01-1994
DF514 Søvnrædsel 01-01-1994
DF515 Natlige mareridt 01-01-1994
DF517 Søvnforstyrrelser, extern betinget 01-04-2006 31-12-2011
DF518 Anden form for ikke-organisk søvnforstyrrelse 01-01-1994
DF518A Eksternt betinget søvnforstyrrelse UNS 01-01-2012
DF519 Ikke-organisk søvnforstyrrelse UNS 01-01-1994
DF52 Ikke-organiske seksuelle funktionsforstyrrelser 01-01-1994
DF520 Nedsat eller manglende seksuallyst 01-01-1994
DF521 Seksuel aversion eller manglende seksuel lystfølelse 01-01-1994
DF5210 Seksuel aversion 01-01-1995
DF5211 Manglende seksuel lystfølelse 01-01-1994
DF522 Ikke-organisk genital dysfunktion 01-01-1994
DF522A Psykogen impotens 01-01-2012
DF523 Hæmmet orgasme 01-01-1994
DF524 Præmatur ejakulation 01-01-1994
DF525 Ikke-organisk vaginisme 01-01-1994
DF526 Ikke-organisk dyspareuni 01-01-1994
DF527 Øget seksualdrift 01-01-1994
DF528 Anden ikke-organisk seksuel dysfunktion 01-01-1994
DF529 Ikke-organisk seksuel dysfunktion UNS 01-01-1994
DF529A Impotens (psykogen) 01-01-2002 31-12-2011
DF53 Psykiske lidelser i barselsperioden IKA 01-01-1994
DF530 Lettere psykisk lidelse i barselsperioden IKA 01-01-1994
DF530A Barselsdepression 01-07-2005
DF531 Svær psykisk lidelse i barselsperioden IKA 01-01-1994
DF538 Anden psykisk lidelse i barselsperioden IKA 01-01-1994
DF539 Psykisk lidelse i barselsperioden UNS 01-01-1994
DF54 Psykiske faktorer forbundet med sygdomme klas. andetsteds 01-01-1994
DF549 Psykiske faktorer forbundet med sygdom klas. andetsteds 01-01-1994
DF55 Misbrug af ikke-afhængighedsskabende stoffer 01-01-1994
DF550 Misbrug af antidepressiva 01-01-1994
DF551 Misbrug af laksantia 01-01-1994
DF552 Misbrug af ikke-psykoaktive analgetika 01-01-1994
DF553 Misbrug af antacida 01-01-1994
DF554 Misbrug af vitaminer 01-01-1994
DF555 Misbrug af steroider eller hormoner 01-01-1994
DF556 Misbrug af naturmedicin 01-01-1994
DF558 Misbrug af andre ikke-afhængighedsskabende stoffer 01-01-1994
DF559 Misbrug af ikke-afhængighedsskabende stoffer UNS 01-01-1994
DF59 Adfærdsændring forbundet m fysiologiske/fysiske faktorer UNS 01-01-1994
DF599 Adfærdsændring UNS forbundet m fysiologisk el fysisk faktor 01-01-1994
DF60 Specifikke forstyrrelser af personlighedsstrukturen 01-01-1994
DF600 Paranoid personlighedsstruktur 01-01-1994
DF601 Skizoid personlighedsstruktur 01-01-1994
DF602 Dyssocial personlighedsstruktur 01-01-1994
DF603 Emotionelt ustabil personlighedsstruktur 01-01-1994
DF6030 Emotionelt ustabil personlighedsstruktur af impulsiv type 01-01-1995
DF6031 Emotionelt ustabil personlighedsstruktur af borderline type 01-01-1994
DF604 Histrionisk personlighedsstruktur 01-01-1994
DF605 Tvangspræget personlighedsstruktur 01-01-1994
DF606 Ængstelig personlighedsstruktur 01-01-1994
DF607 Dependent personlighedsstruktur 01-01-1994
DF608 Anden forstyrrelse af personlighedsstrukturen 01-01-1994
DF609 Forstyrrelse i personlighedsstrukturen UNS 01-01-1994
DF61 Forstyrrelser i personlighedsstruktur af bl. og an. type 01-01-1994
DF610 Forstyrrelse i personlighedsstruktur af blandet type 01-01-1994
DF611 Personlighedsændring ved primær affektiv lidelse/angsttilst. 01-01-1994
DF619 Forstyrret personlighedsstruktur af blandet og anden type 01-01-1994 31-12-2011
DF62 Ikke-organiske personlighedsændringer 01-01-1994
DF620 Personlighedsændring efter katastrofeoplevelse 01-01-1994
DF621 Personlighedsændring efter psykisk sygdom 01-01-1994
DF628 Anden personlighedsændring 01-01-1994
DF629 Personlighedsændring UNS 01-01-1994
DF63 Patologiske vane- og impulshandlinger 01-01-1994
DF630 Patologisk spillelidenskab 01-01-1994
DF631 Pyromani 01-01-1994
DF632 Kleptomani 01-01-1994
DF633 Trikotillomani 01-01-1994
DF633A Trichotillomania, adult 01-04-2000 31-12-2011
DF633B Trichotillomania, juvenil 01-04-2000 31-12-2011
DF638 Anden patologisk vane- og impulshandling 01-01-1994
DF639 Patologisk vane- og impulshandling UNS 01-01-1994
DF64 Kønsidentitetsforstyrrelser 01-01-1994 31-12-2016
DF640 Transseksualisme 01-01-1994 31-12-2016
DF641 Transvestisme 01-01-1994 19-08-1994
DF642 Kønsidentitetsforstyrrelse i barndommen 01-01-1994 31-12-2016
DF648 Anden kønsidentitetsforstyrrelse 01-01-1994 31-12-2016
DF649 Kønsidentitetsforstyrrelse UNS 01-01-1994 31-12-2016
DF65 Seksuelle afvigelser 01-01-1994
DF650 Fetichisme 01-01-1994
DF651 Transvestisk fetichisme 01-01-1994 30-06-2016
DF652 Exhibitionisme 01-01-1994
DF653 Voyeurisme 01-01-1994
DF654 Pædofili 01-01-1994
DF655 Sadomasochisme 01-01-1994 01-05-1995
DF656 Blandet seksuel afvigelser 01-01-1994
DF658 Anden seksuel afvigelse 01-01-1994
DF659 Seksuel afvigelse UNS 01-01-1994
DF66 Seksuelle udviklings- og orienteringsforstyrrelser 01-01-1994
DF660 Seksuel modningsforstyrrelse 01-01-1994
DF661 Egodyston seksualorientering 01-01-1994
DF662 Seksuel forholdsforstyrrelse 01-01-1994
DF668 Anden psykoseksuel udviklingsforstyrrelse 01-01-1994
DF669 Psykoseksuel udviklingsforstyrrelse UNS 01-01-1994
DF68 An. forstyrr. i personlighedsstruktur og adfærd hos voksne 01-01-1994
DF680 Psykisk udbygning af somatiske symptomer 01-01-1994
DF681 Sygdomsefterligning helt eller delvist bevidst 01-01-1994
DF681A Secretans syndrom 01-04-2000
DF681B Patomimi 01-04-2000
DF681C Selvmutilation UNS 01-01-2012
DF681D Münchhausens syndrom 01-01-2012
DF688 An. forstyrr. i personlighed, struktur og adfærd hos voksen 01-01-1994
DF69 Forstyrr. i personlighedsstruktur og adfærd UNS 01-01-1994
DF699 Forstyrrelse i personlighedsstruktur og adfærd UNS 01-01-1994
DF70 Mental retardering af lettere grad 01-01-1994
DF700 Lettere mental retardering med ringe påvirkning af adfærd 01-01-1994
DF701 Lettere mental retardering m. væsentlig påvirkning af adfærd 01-01-1994
DF708 Lettere mental retardering med anden påvirkning af adfærd 01-01-1994
DF709 Lettere mental retardering med påvirkning af adfærd UNS 01-01-1994
DF71 Mental retardering af middelsvær grad 01-01-1994
DF710 Middelsvær mental retardering med ringe påvirkning af adfærd 01-01-1994
DF711 Middelsvær mental retardering m væsentlig påvirkn. af adfærd 01-01-1994
DF718 Middelsvær mental retardering med anden påvirkning af adfærd 01-01-1994
DF719 Middelsvær mental retardering med påvirkning af adfærd UNS 01-01-1994
DF72 Mental retardering af sværere grad 01-01-1994
DF720 Sværere mental retardering med ringe påvirkning af adfærd 01-01-1994
DF721 Sværere mental retardering m. væsentlig påvirkning af adfærd 01-01-1994
DF728 Sværere mental retardering med anden påvirkning af adfærd 01-01-1994
DF729 Sværere mental retardering med påvirkning af adfærd UNS 01-01-1994
DF73 Mental retardering i sværeste grad 01-01-1994
DF730 Mental retardering i sværeste grad med ringe adfærdspåvirk. 01-01-1994
DF731 Mental retardering i sværeste grad m væsentlig adfærdspåvirk 01-01-1994
DF738 Mental retardering i sværeste grad med an. påvirk. af adfærd 01-01-1994
DF739 Mental retardering i sværeste grad med adfærdspåvirkning UNS 01-01-1994
DF78 Anden mental retardering 01-01-1994
DF780 Anden mental retardering med ringe påvirkning af adfærd 01-01-1994
DF781 Anden mental retardering med væsentlig påvirkning af adfærd 01-01-1994
DF788 Anden mental retardering med anden påvirkning af adfærd 01-01-1994
DF789 Anden mental retardering med påvirkning af adfærd UNS 01-01-1994
DF79 Mental retardering uden specificering 01-01-1994
DF790 Mental retardering UNS med ringe påvirkning af adfærd 01-01-1994
DF791 Mental retardering UNS med væsentlig påvirkning af adfærd 01-01-1994
DF798 Mental retardering UNS med anden påvirkning af adfærd 01-01-1994
DF799 Mental retardering UNS 01-01-1994
DF80 Specifikke udviklingsforstyrrelser af tale og sprog 01-01-1994
DF800 Specifik sprogartikulationsforstyrrelse 01-01-1994
DF801 Ekspressiv dysfasi 01-01-1994
DF802 Impressiv dysfasi 01-01-1994
DF803 Epileptisk afasi 01-01-1994
DF808 Anden udviklingsforstyrrelse af tale eller sprog 01-01-1994
DF809 Udviklingsforstyrrelse af tale og sprog UNS 01-01-1994
DF809A Verbal dyspraksi 01-01-2018
DF81 Specifikke udviklingsforstyrrelser af skolefærdigheder 01-01-1994
DF810 Specifik læseforstyrrelse 01-01-1994
DF811 Specifik staveforstyrrelse 01-01-1994
DF812 Specifik regneforstyrrelse 01-01-1994
DF813 Blandet udviklingsforstyrrelse af skolefærdigheder 01-01-1994
DF818 Anden udviklingsforstyrrelse af skolefærdigheder 01-01-1994
DF819 Udviklingsforstyrrelse af skolefærdigheder UNS 01-01-1994
DF82 Specifikke udviklingsforstyrrelser af motoriske færdigheder 01-01-1994
DF829 Specifik udviklingsforstyrrelse af motoriske færdigheder 01-01-1994
DF829A Oral dyspraksi 01-01-2018
DF83 Blandede udviklingsforstyrrelser af specifikke færdigheder 01-01-1994
DF839 Blandet udviklingsforstyrrelse af specifikke færdigheder 01-01-1994
DF84 Gennemgribende mentale udviklingsforstyrrelser 01-01-1994
DF840 Infantil autisme 01-01-1994
DF841 Atypisk autisme 01-01-1994
DF8410 Autisme atypisk med hensyn til begyndelsesalder 01-01-1995
DF8411 Autisme atypisk med hensyn til symptomatologi 01-01-1994
DF8412 Autisme atypisk mht både begyndelsesalder og symptomatologi 01-01-1994
DF842 Retts syndrom 01-01-1994
DF843 Anden disintegrativ forstyrrelse i barndommen 01-01-1994
DF844 Hyperaktivitetsforstyr. m. retardering/bevægelsesstereotypi 01-01-1994
DF845 Aspergers syndrom 01-01-1994
DF848 Anden gennemgribende mental udviklingsforstyrrelse 01-01-1994
DF849 Gennemgribende mental udviklingsforstyrrelse UNS 01-01-1994
DF88 Andre psykiske udviklingsforstyrrelser 01-01-1994
DF889 Psykisk udviklingsforstyrrelse IKA 01-01-1994
DF89 Psykiske udviklingsforstyrrelser uden specificering 01-01-1994
DF899 Psykisk udviklingsforstyrrelse UNS 01-01-1994
DF90 Hyperkinetiske forstyrrelser 01-01-1994
DF900 Forstyrrelse af aktivitet og opmærksomhed 01-01-1994
DF901 Hyperkinetisk adfærdsforstyrrelse 01-01-1994
DF908 Anden hyperkinetisk forstyrrelse 01-01-1994
DF909 Hyperkinetisk forstyrrelse UNS 01-01-1994
DF91 Adfærdsforstyrrelser 01-01-1994
DF910 Adfærdsforstyrrelse begrænset til familien 01-01-1994
DF911 Usocialiseret adfærdsforstyrrelse 01-01-1994
DF912 Socialiseret adfærdsforstyrrelse 01-01-1994
DF913 Oppositionel adfærdsforstyrrelse 01-01-1994
DF918 Anden adfærdsforstyrrelse 01-01-1994
DF919 Adfærdsforstyrrelse UNS 01-01-1994
DF92 Blandede adfærds- og følelsesmæssige forstyrrelser 01-01-1994
DF920 Depressiv adfærdsforstyrrelse 01-01-1994
DF928 Andre blandede adfærds- og følelsesmæssig forstyrrelser 01-01-1994
DF929 Blandet adfærds- og følelsesmæssig forstyrrelse UNS 01-01-1994
DF93 Emotionelle forstyrrelser opstået i barndommen 01-01-1994
DF930 Abnorm separationsangst i barndom 01-01-1994
DF931 Fobisk angsttilstand i barndom 01-01-1994
DF932 Socialangsttilstand i barndom 01-01-1994
DF933 Overdreven søskendejalousi 01-01-1994
DF938 Anden emotionel forstyrrelse i barndom 01-01-1994
DF9380 Generel angsttilstand i barndommen 01-01-1995
DF939 Emotionel forstyrrelse i barndom UNS 01-01-1994
DF94 Sociale funktionsforstyrrelser i barndom og adolescens 01-01-1994
DF940 Elektiv mutisme 01-01-1994
DF941 Reaktiv tilknytningsforstyrrelse i barndom 01-01-1994
DF942 Uselektiv, uhæmmet tilknytnings- eller kontaktform 01-01-1994
DF948 Anden social funktionsforstyrrelse 01-01-1994
DF949 Social funktionsforstyrrelse UNS 01-01-1994
DF95 Tics 01-01-1994
DF950 Forbigående tic 01-01-1994
DF951 Kroniske motoriske eller vokale tics 01-01-1994
DF952 Kombinerede vokale og multiple motoriske tics 01-01-1994
DF958 Anden tic-lidelse 01-01-1994
DF959 Tics UNS 01-01-1994
DF98 An. adfærd/emotionel forstyrr. opstået i barndom/adolescens 01-01-1994
DF980 Ikke-organisk enuresis 01-01-1994
DF9800 Ikke-organisk enuresis alene om natten 01-01-1995
DF9801 Ikke-organisk enuresis alene om dagen 01-01-1994
DF9802 Ikke-organisk enuresis både nat og dag 01-01-1994
DF981 Ikke-organisk encoprese 01-01-1994
DF9810 Ikke-organisk encoprese med manglende sfinkterkontrol 01-01-1995
DF9811 Ikke-organisk encoprese med normal sfinkterkontrol og fæces 01-01-1994
DF9812 Ikke-organisk encoprese med flydende fæces 01-01-1994
DF982 Spiseforstyrrelse i barndommen 01-01-1994
DF983 Pica i barndommen 01-01-1994
DF984 Bevægelsesstereotypier 01-01-1994
DF9840 Ikke-selvskadende bevægelsesstereotypier 01-01-1995
DF9841 Selvskadende bevægelsesstereotypier 01-01-1994
DF9842 Blandede bevægelsesstereotypier 01-01-1994
DF985 Stammen 01-01-1994
DF986 Støden 01-01-1994
DF988 An. adfærd/emotionel forstyrr. opstået i barndom/adolescens 01-01-1994
DF988A Onychophagia 01-04-2000
DF988B Onychotillomania 01-04-2000
DF988C Opmærksomhedsforstyrrelse uden hyperaktivitet 01-01-2009
DF989 Adfærdsmæssig/emotionel forstyrr. i barndom/adolescens UNS 01-01-1994
DF99 Psykiske lidelser eller forstyrrelser ikke nærmere spec. 01-01-1994
DF999 Psykisk lidelse eller forstyrrelse UNS 01-01-1994
DG00 Meningitis forårsaget af bakterier IKA 01-01-1994
DG000 Meningitis forårsaget af Haemophilus influenzae 01-01-1994
DG001 Meningitis forårsaget af pneumokokker 01-01-1994
DG002 Meningitis forårsaget af andre streptokokker 01-01-1994
DG003 Meningitis forårsaget af stafylokokker 01-01-1994
DG008 Anden bakteriel meningitis 01-01-1994
DG008A Meningitis forårsaget af Klebsiella 01-01-1994
DG008B Meningitis forårsaget af Escherichia coli 01-01-1994
DG009 Bakteriel meningitis UNS 01-01-1994
DG009A Meningitis purulenta UNS 01-01-1994
DG01 Meningitis ved bakterielle sygdomme klassificeret andetsteds 01-01-1994
DG019 Meningitis ved bakteriesygdom klassificeret andetsteds 01-01-1994
DG019A Meningitis, sekundær syfilis 01-01-1994 31-12-2011
DG019B Meningitis, tyfus 01-01-1994 31-12-2011
DG019C Meningitis salmonellosa 01-01-1994 31-12-2011
DG019D Meningitis, antraks 01-01-1994 31-12-2011
DG019E Meningitis, kongenit syfilis 01-01-1994 31-12-2011
DG019F Meningitis, neurosyfilis 01-01-1994 31-12-2011
DG019G Meningitis, leptospirosis 01-01-1994 31-12-2011
DG019H Meningitis gonococcica 01-01-1994 31-12-2011
DG019I Meningitis, Listeria 01-01-1994 31-12-2011
DG019J Meningitis, Lyme's sygdom 01-01-1994 31-12-2011
DG02 Meningitis ved andre infektiøse og parasitære sygdomme KA 01-01-1994
DG020 Meningitis ved viral sygdom klassificeret andetsteds 01-01-1994
DG020A Meningitis, varicella 01-01-1994 31-12-2011
DG020B Meningitis, rubella 01-01-1994 31-12-2011
DG020C Meningitis, adenovirus 01-01-1994 31-12-2011
DG020D Meningitis, parotitis 01-01-1994 31-12-2011
DG020E Meningitis, mononucleosis 01-01-1994 31-12-2011
DG020F Meningitis, enterovirus 01-01-1994 31-12-2011
DG020G Meningitis, morbilli 01-01-1994 31-12-2011
DG021 Meningitis ved mykose klassificeret andetsteds 01-01-1994
DG021A Meningitis, candida 01-01-1994 31-12-2011
DG021B Meningitis, coccidioidomykosis 01-01-1994 31-12-2011
DG021C Meningitis, cryptococcosis 01-01-1994 31-12-2011
DG021D Meningitis ved mykose klassificeret andetsteds 01-01-1994 31-12-2011
DG028 Meningitis ved anden infektiøs eller parasitær sygdom KA 01-01-1994
DG028A Meningitis, trypanosoma 01-01-1994 31-12-2011
DG03 Hjernehindebetændelse af andre og ikke specificerede årsager 01-01-1994
DG030 Ikke-infektiøs meningitis 01-01-1994
DG031 Kronisk meningitis 01-01-1994
DG032 Godartet recidiverende meningitis 01-01-1994
DG038 Meningitis af anden årsag 01-01-1994
DG039 Meningitis UNS 01-01-1994
DG04 Hjerne- og rygmarvsbetændelse 01-01-1994
DG040 Akut dissemineret encephalitis 01-01-1994
DG040A Encephalitis eller encephalomyelitis efter vaccination 01-01-1994
DG041 Human T-celle lymphotrop virus associeret myelopati 01-01-1994
DG042 Bakteriel meningoencephalitis eller meningomyelitis IKA 01-01-1994
DG042A Bakteriel meningomyelitis IKA 01-01-1994
DG042B Bakteriel meningoencephalitis IKA 01-01-2012
DG048 Anden encephalitis, myelitis eller encephalomyelitis 01-01-1994
DG048A Postinfektiøs encephalitis IKA 01-01-1994
DG048B Postinfektiøs encephalomyelitis IKA 01-01-1994
DG048C Postinfektiøs myelitis IKA 01-01-1994
DG049 Encephalitis, myelitis eller encephalomyelitis UNS 01-01-1994
DG049A Encephalitis UNS 01-01-1994
DG049B Encephalomyelitis UNS 01-01-1994
DG049C Myelitis UNS 01-01-1994
DG049D Cerebral ventrikulitis UNS 01-01-2012
DG05 Hjerne- og rygmarvsbetændelse ved sygdomme klas. andetsteds 01-01-1994
DG050 Encephalitis, myelitis og encephalomyelit v bakterie-sygd KA 01-01-1994
DG050A Encephalitis syphilitica congenita 01-01-1994 31-12-2011
DG050B Encephalitis tuberculosa 01-01-1994 31-12-2011
DG050C Encephalitis syphilitica tarda 01-01-1994 31-12-2011
DG050D Encephalitis, listeria 01-01-1994 31-12-2011
DG050E Encephalitis meningococcica 01-01-1994 31-12-2011
DG050F Encephalomyelitis tuberculosa 01-01-1994 31-12-2011
DG050G Encephalomyelitis syphilitica tarda 01-01-1994 31-12-2011
DG050H Encephalomyelitis, listeria 01-01-1994 31-12-2011
DG050I Encephalomyelitis meningococcica 01-01-1994 31-12-2011
DG050J Encephalomyelitis syphilitica congenita 01-01-1994 31-12-2011
DG050K Myelitis, listeria 01-01-1994 31-12-2011
DG050L Myelitis, sensyfilitisk 01-01-1994 31-12-2011
DG050M Myelitis syphilitica congenita 01-01-1994 31-12-2011
DG050N Myelitis tuberculosa 01-01-1994 31-12-2011
DG050O Myelitis meningococcica 01-01-1994 31-12-2011
DG050P Encephalitis ved bakteriel sygdom klassificeret andetsteds 01-01-2012
DG050R Encephalomyelitis ved bakteriel sygdom klas. andetsteds 01-01-2012
DG050S Myelitis ved bakteriel sygdom klassificeret andetsteds 01-01-2012
DG051 Encephalitis, myelitis og encephalomyelit ved viral sygd. KA 01-01-1994
DG051A Encephalitis, rubella 01-01-1994 31-12-2011
DG051B Encephalitis, parotitis 01-01-1994 31-12-2011
DG051C Encephalitis, enterovirus 01-01-1994 31-12-2011
DG051D Encephalitis, morbilli 01-01-1994 31-12-2011
DG051E Encephalitis herpetica 01-01-1994 31-12-2011
DG051F Encephalitis, influenza 01-01-1994 31-12-2011
DG051G Encephalitis, cytomegalvirus 01-01-1994 31-12-2011
DG051H Encephalitis efter varicella 01-01-1994 31-12-2011
DG051I Encephalitis, zoster 01-01-1994 31-12-2011
DG051J Encephalitis, adenovirus 01-01-1994 31-12-2011
DG051K Myelitis efter variceler 01-01-1994 31-12-2011
DG051L Myelitis, cytomegalvirus 01-01-1994 31-12-2011
DG051M Myelitis, zoster 01-01-1994 31-12-2011
DG051N Myelitis, adenovirus 01-01-1994 31-12-2011
DG051O Myelitis, influenza 01-01-1994 31-12-2011
DG051P Myelitis herpetica 01-01-1994 31-12-2011
DG051Q Myelitis, rubella 01-01-1994 31-12-2011
DG051R Myelitis, parotitis 01-01-1994 31-12-2011
DG051S Myelitis, morbilli 01-01-1994 31-12-2011
DG051T Myelitis, enterovirus 01-01-1994 31-12-2011
DG051U Encephalitis ved viral sygdom klassificeret andetsteds 01-01-2012
DG051V Encephalomyelitis ved viral sygdom klassificeret andetsteds 01-01-2012
DG051X Myelitis ved viral sygdom klassificeret andetsteds 01-01-2012
DG052 Encephalit, myelit, encephalomyelit v an.infekt/parasit.sygd 01-01-1994
DG052A Encephalitis, trypanosomiasis 01-01-1994 31-12-2011
DG052B Encephalitis, toxoplasmosis 01-01-1994 31-12-2011
DG052C Encephalitis, naegleriasis 01-01-1994 31-12-2011
DG052D Encephalomyelitis, naegleriasis 01-01-1994 31-12-2011
DG052E Encephalomyelitis, toxoplasmosis 01-01-1994 31-12-2011
DG052F Encephalomyelitis, trypanosomiasis 01-01-1994 31-12-2011
DG052G Meningoencephalitis eosinophilica 01-01-1994 31-12-2011
DG052H Myelitis, toxoplasmosis 01-01-1994 31-12-2011
DG052I Myelitis, trypanosomiasis 01-01-1994 31-12-2011
DG052J Myelitis, naegleriasis 01-01-1994 31-12-2011
DG052K Encephalitis ved anden infektiøs eller parasitær sygdom KA 01-01-2012
DG052L Myelitis ved anden infektiøs eller parasitær sygdom KA 01-01-2012
DG052M Encephalomyelitis v. anden infektiøs el. parasitær sygdom KA 01-01-2012
DG052N Meningoencephalitis ved anden infektiøs/parasitær sygdom KA 01-01-2012
DG058 Encephalitis, myelitis og encephalomyelitis v. an. sygdom KA 01-01-1994
DG058A Encephalitis, systemisk lupus erythematosus 01-01-1994 31-12-2011
DG06 Intrakraniel og intraspinal absces og granulom 01-01-1994
DG060 Intrakraniel absces eller granulom 01-01-1994
DG060A Intrakraniel epidural absces 01-01-1994
DG060B Intrakraniel subdural absces 01-01-1994
DG060C Intrakraniel otogen absces 01-01-1994
DG060D Abscessus intracranialis epiduralis 01-01-1994 31-12-2011
DG060E Absces i lillehjernen 01-01-1994
DG060F Absces i storhjernen 01-01-1994
DG060G Granulom i lillehjernen 01-01-1994
DG060H Intrakranielt subduralt granulom 01-01-1994
DG060I Intrakranielt otogent granulom 01-01-1994
DG060J Granulom i storhjernen 01-01-1994
DG060K Intrakranielt granulom UNS 01-01-1994
DG060L Intrakranielt epiduralt granulom 01-01-1994
DG060M Granuloma intracraniale extradurale 01-01-1994 31-12-2011
DG061 Intraspinal absces eller granulom 01-01-1994
DG061A Intraspinal subdural absces 01-01-1994
DG061B Abscessus intraspinalis extraduralis 01-01-1994 31-12-2011
DG061C Intraspinal epidural absces 01-01-1994
DG061D Granuloma intraspinale extradurale 01-01-1994 31-12-2011
DG061E Intraspinalt epiduralt granulom 01-01-1994
DG061F Intraspinalt granulom UNS 01-01-1994
DG061G Intraspinalt subduralt granulom 01-01-1994
DG062 Epidural eller subdural absces UNS 01-01-1994
DG062A Epidural absces UNS 01-01-1994
DG062B Abscessus extraduralis uden specifikation 01-01-1994 31-12-2011
DG062C Subdural absces UNS 01-01-1994
DG07 Intrakranielle/intraspinale abscesser/granulomer v. sygd. KA 01-01-1994
DG079 Intrakraniel/intraspinal absces eller granulom ved sygdom KA 01-01-1994
DG079A Intraspinal absces ved sygdom klassificeret andetsteds 01-01-1994
DG079B Intrakraniel absces ved sygdom klassificeret andetsteds 01-01-1994
DG079C Abscessus cerebri tuberculosus 01-01-1994 31-12-2011
DG079D Abscessus cerebri, amøbicus 01-01-1994 31-12-2011
DG079E Abscessus cerebri gonococcicus 01-01-1994 31-12-2011
DG079F Granuloma cerebralis, schistosomiasis 01-01-1994 31-12-2011
DG079G Tuberculoma cerebri 01-01-1994 31-12-2011
DG079H Tuberculoma meninges 01-01-1994 31-12-2011
DG079J Intrakranielt granulom ved sygdom klassificeret andetsteds 01-01-2012
DG079K Intraspinalt granulom ved sygdom klassificeret andetsteds 01-01-2012
DG08 Intrakraniel og intraspinal flebitis og tromboflebitis 01-01-1994
DG089 Intrakraniel eller intraspinal flebitis eller tromboflebitis 01-01-1994
DG089A Embolia intraspinalis pyogenica 01-01-1994 31-12-2011
DG089B Embolia intracranialis pyogenica 01-01-1994 31-12-2011
DG089C Endophlebitis intraspinalis pyogenica 01-01-1994 31-12-2011
DG089D Endophlebitis intracranialis pyogenica 01-01-1994 31-12-2011
DG089E Phlebitis intraspinalis pyogenica 01-01-1994 31-12-2011
DG089F Phlebitis sinus cerebri pyogenica 01-01-1994 31-12-2011
DG089G Phlebitis intracranialis pyogenica 01-01-1994 31-12-2011
DG089H Thrombophlebitis sinuum durae matris pyogenica 01-01-1994 31-12-2011
DG089I Thrombophlebitis cerebralis pyogenica 01-01-1994 31-12-2011
DG089J Thrombophlebitis intracranialis pyogenica 01-01-1994 31-12-2011
DG089K Thrombophlebitis intraspinalis pyogenica 01-01-1994 31-12-2011
DG089L Thrombosis sinus cerebri pyogenica 01-01-1994 31-12-2011
DG089M Thrombosis intracranialis pyogenica 01-01-1994 31-12-2011
DG089N Thrombosis intraspinalis pyogenica 01-01-1994 31-12-2011
DG09 Følger efter betændelsessygdomme i centralnervesystemet 01-01-1994
DG099 Følge efter inflammatorisk sygdom i centralnervesystemet 01-01-1994
DG10 Huntingtons sygdom 01-01-1994
DG109 Huntingtons sygdom 01-01-1994
DG11 Arvelig ataksi og paraplegi 01-01-1994
DG110 Ataxia nonprogressiva congenita 01-01-1994
DG111 Ataxia cerebellaris med tidlig debut 01-01-1994
DG111A Kønsbunden recessiv ataxia spinocerebellaris 01-01-1994
DG111B Ataxia spinalis hereditaria 01-01-1994
DG111C Friedreichs ataksi 01-01-1994
DG112 Ataxia cerebellaris med sen debut 01-01-1994
DG112A Ataxia cerebellaris hereditaria med sen debut (efter 20 år) 01-01-1994 31-12-2011
DG113 Ataxia cerebellaris med defekt DNA-reparation 01-01-1994
DG113A Ataxia telangiectasia 01-01-1994
DG113B Louis-Bar's syndrom 01-01-1994 31-12-2011
DG114 Arvelig spastisk paraplegi 01-01-1994
DG118 Anden arvelig ataksi 01-01-1994
DG119 Arvelig ataksi UNS 01-01-1994
DG12 Spinale muskelatrofier og beslægtede syndromer 01-01-1994
DG120 Atrophia musculorum spinalis, type I 01-01-1994
DG121 Anden arvelig spinal muskelatrofi 01-01-1994
DG121A Atrophia musculorum spinalis, voksen form 01-01-1994
DG121B Atrophia musculorum spinalis, skapuloperoneal form 01-01-1994
DG121C Atrophia musculorum spinalis, distal form 01-01-1994
DG121D Atrophia musculorum spinalis, type II 01-01-1994
DG121E Atrophia musculorum spinalis, type III 01-01-1994
DG121F Progressiv bulbær parese hos barn 01-01-1994
DG121G Kugelberg-Welander syndrom 01-01-1994 31-12-2011
DG122 Sygdom i motorneuroner 01-01-1994
DG122A Atrophia musculorum progressiva spinalis 01-01-1994
DG122B Atrophia musculorum progressiva myelopathica 01-01-1994
DG122C Atrophia musculorum Duchenne-Aran 01-01-1994
DG122D Atrophia musculorum progressiva 01-01-1994
DG122E Paralysis spinalis progressiva 01-01-1994
DG122F Paralysis bulbaris progressiva 01-01-1994
DG122G Amyotrofisk lateralsklerose 01-01-1994
DG128 Anden spinal muskelatrofi eller beslægtet syndrom 01-01-1994
DG129 Spinal muskelatrofi UNS 01-01-1994
DG13 Generelle atrofier, som primært afficerer CNS, ved sygd. KA 01-01-1994
DG130 Paraneoplastisk neuromyopati og neuropati 01-01-1994
DG130A Neuromyopathia carcinomatosa 01-01-1994 31-12-2011
DG130B Neuromyopathia paraneoplastica 01-01-1994 31-12-2011
DG130C Neuropathia paraneoplastica 01-01-1994 31-12-2011
DG130D Neuropathia paraneoplastica sensorica (Denny Brown) 01-01-1994 31-12-2011
DG131 Anden generel atrofi i CNS ved neoplastisk sygdom 01-01-1994
DG132 Generel atrofi, som primært afficerer CNS, ved myksødem 01-01-1994
DG138 Generel atrofi, som primært afficerer CNS, ved anden sygdom 01-01-1994
DG14 Postpoliosyndrom 01-01-2012
DG149 Postpolio myelitisk syndrom 01-01-2012
DG20 Parkinsons sygdom 01-01-1994
DG209 Parkinsons sygdom 01-01-1994
DG209A Hemiparkinsonisme 01-01-1994
DG21 Sekundær parkinsonisme 01-01-1994
DG210 Malignt neuroleptikasyndrom 01-01-1994
DG211 Anden medikamentel parkinsonisme 01-01-1994
DG212 Sekundær parkinsonisme forårsaget af andet eksternt agens 01-01-1994
DG213 Postencephalitisk parkinsonisme 01-01-1994
DG214 Vaskulær parkinsonisme 01-01-2013
DG218 Anden sekundær parkinsonisme 01-01-1994
DG218A Parkinsonismus arterioscleroticus 01-01-1994
DG219 Sekundær parkinsonisme UNS 01-01-1994
DG22 Parkinsonisme ved sygdomme klassificeret andetsteds 01-01-1994
DG229 Parkinsonisme ved sygdom klassificeret andetsteds 01-01-1994
DG229A Parkinsonismus syphiliticus 01-01-1994 31-12-2011
DG23 Andre degenerative sygdomme i basalganglier 01-01-1994
DG230 Hallervorden-Spatz sygdom 01-01-1994
DG231 Progressiv supranukleær oftalmoplegi 01-01-1994
DG231A Steele-Richardson-Olszewski syndrom 01-01-1994 31-12-2011
DG232 Multipel system atrofi, parkinson type (MSA-P) 01-01-1994
DG233 Multipel system atrofi, cerebellar type (MSA-C) 01-01-2016
DG238 Anden degenerativ sygdom i basalganglier 01-01-1994
DG239 Degenerativ sygdom i basalganglier UNS 01-01-1994
DG24 Dystoni 01-01-1994
DG240 Dystoni forårsaget af lægemiddel 01-01-1994
DG240A Dyskinesia tardiva 01-01-2012
DG241 Idiopatisk familiær dystoni 01-01-1994
DG242 Idiopatisk ikke-familiær dystoni 01-01-1994
DG243 Spastisk torticollis 01-01-1994
DG244 Idiopatisk orofacial dystoni 01-01-1994
DG245 Blefarospasme 01-01-1994
DG248 Anden dystoni 01-01-1994
DG248A Dyskinesia tardiva 01-01-1994 31-12-2011
DG249 Dystoni UNS 01-01-1994
DG25 Andre ekstrapyramidale sygdomme og bevægeforstyrrelser 01-01-1994
DG250 Essentiel tremor 01-01-1994
DG251 Tremor forårsaget af lægemiddel 01-01-1994
DG252 Anden form for tremor 01-01-1994
DG252A Intentionstremor 01-01-1994
DG253 Myoclonus 01-01-1994
DG253A Myoclonus forårsaget af lægemiddel 01-01-1994
DG254 Chorea forårsaget af lægemiddel 01-01-1994
DG255 Anden form for chorea 01-01-1994
DG255A Chorea UNS 01-01-1994
DG256 Tics forårsaget af lægemiddel eller andre organiske tics 01-01-1994
DG256A Tics på organisk grundlag UNS 01-01-1994
DG258 Anden ekstrapyramidal sygdom eller bevægeforstyrrelse 01-01-1994
DG258A Restless legs syndrom 01-01-1994
DG258B Asthenia crurum paraesthetica og dolorosa 01-01-1994 31-12-2011
DG258C Restless legs 01-01-1994 31-12-2006
DG258D Stiff man-syndrom 01-01-1994
DG259 Ekstrapyramidal sygdom eller bevægeforstyrrelse UNS 01-01-1994
DG26 Ekstrapyramidale sygd. og bevægeforstyrrelser v. sygdomme KA 01-01-1994
DG269 Ekstrapyramidal sygdom el. bevægeforstyrrelse ved sygdom KA 01-01-1994
DG30 Alzheimers sygdom 01-01-1994
DG300 Alzheimers sygdom med tidlig debut 01-01-1994
DG301 Alzheimers sygdom med sen debut 01-01-1994
DG308 Anden form for Alzheimers sygdom 01-01-1994
DG309 Alzheimers sygdom UNS 01-01-1994
DG31 Andre degenerative sygdomme i nervesystemet IKA 01-01-1994
DG310 Lokaliseret hjerneatrofi 01-01-1994
DG310A Progressiv isoleret afasi 01-01-1994
DG310B Picks sygdom 01-01-1994
DG311 Senil degeneration af hjernen IKA 01-01-1994
DG312 Degenerative forandringer i nervesystemet f.a. alkohol 01-01-1994
DG312A Alkoholisk cerebellar ataksi 01-01-1994
DG312B Alkoholisk cerebral degeneration 01-01-1994
DG312C Alkoholisk cerebellar degeneration 01-01-1994
DG312D Alkoholisk dysfunktion af det autonome nervesystem 01-01-1994
DG312E Alkoholisk encefalopati 01-01-1994
DG318 Anden degenerativ sygdom i nervesystemet 01-01-1994
DG318A Alpers' sygdom 01-01-1994
DG318B Hjernebarksdegeneration 01-01-1994
DG318C Subakut nekrotiserende encefalopati 01-01-1994
DG318D Leigh's sygdom 01-01-1994 31-12-2011
DG318E Lewy body sygdom 01-10-2008
DG319 Degenerativ sygdom i nervesystemet UNS 01-01-1994
DG32 Andre degenerative tilstande i nervesystemet ved sygdomme KA 01-01-1994
DG320 Subakut degeneration af rygmarven v. sygdom klas. andetsteds 01-01-1994
DG320A Degeneratio medullae spinalis subacuta ved B vitaminmangel 01-01-1994 31-12-2011
DG328 Anden degenerativ tilstand i nervesystemet ved sygdom KA 01-01-1994
DG35 Dissemineret sklerose 01-01-1994
DG359 Dissemineret sklerose UNS 01-01-1994
DG359A Attakvis dissemineret sklerose 01-01-2000
DG359B Primær dissemineret sklerose 01-01-2000
DG359C Progressiv dissemineret sklerose 01-01-2000
DG36 Anden akut dissemineret demyelinisering 01-01-1994
DG360 Neuromyelitis optica 01-01-1994
DG360A Devic's sygdom 01-01-1994 31-12-2011
DG361 Akut eller subakut hæmoragisk leukoencephalitis 01-01-1994
DG361A Leukoencephalitis haemorrhagica subacuta 01-01-1994 31-12-2011
DG361B Leukoencephalitis haemorrhagica acuta 01-01-1994 31-12-2011
DG368 Anden akut dissemineret demyelinisering 01-01-1994
DG369 Akut dissemineret demyelinisering UNS 01-01-1994
DG37 Andre demyeliniserende sygdomme i centralnervesystemet 01-01-1994
DG370 Diffus cerebral sklerose 01-01-1994
DG370A Encephalitis periaxialis 01-01-1994
DG370B Schilder's sygdom 01-01-1994 31-12-2011
DG371 Demyelinisatio centralis corporis callosi 01-01-1994
DG372 Myelinolysis pontis centralis 01-01-1994
DG373 Akut tranversel myelitis ved demyeliniserende sygdom i CNS 01-01-1994
DG373A Akut tranversel myelitis UNS 01-01-1994
DG374 Subakut nekrotiserende myelitis 01-01-1994
DG375 Encephalitis periaxialis concentrica 01-01-1994
DG378 Anden demyeliniserende sygdom i centralnervesystemet 01-01-1994
DG379 Demyeliniserende sygdom i centralnervesystemet UNS 01-01-1994
DG40 Epilepsi 01-01-1994
DG400 Fokal idiopatisk epilepsi 01-01-1994
DG400A Benign børneepilepsi med centrotemporale spikes 01-01-1994
DG400B Benign børneepilepsi med occipitale paroxysmer 01-01-1994
DG400C Epilepsia rolandica 01-01-1994 31-03-2006
DG400D Autosomal dominant natlig frontallapsepilepsi 01-01-1994
DG401 Fokal epilepsi kun med simple anfald 01-01-1994
DG401A Frontallapsepilepsi kun med simple fokale anfald 01-01-2006
DG401B Parietallapsepilepsi kun med simple fokale anfald 01-01-2006
DG401C Occipitallapsepilepsi kun med simple fokale anfald 01-01-2006
DG401D Temporallapsepilepsi kun med simple fokale anfald 01-01-2006
DG401E Temporallapsepilepsi m hippocampussklerose kun simple anfald 01-01-2006
DG402 Fokal epilepsi m komplekse/gen. tonisk-klonisk anfald (GTCS) 01-01-1994
DG402A Frontallapsepilepsi med komplekse anfald eller GTCS 01-01-2006
DG402B Parietallapsepilepsi med komplekse fokale anfald eller GTCS 01-01-2006
DG402C Occipitallapsepilepsi med komplekse fokale anfald eller GTCS 01-01-2006
DG402D Temporallapsepilepsi med komplekse fokale anfald eller GTCS 01-01-2006
DG402E Temporallapsepilepsi m hippo-sklerose m kompl.anfald/gen.TCS 01-01-2006
DG403 Generaliseret idiopatisk epilepsi 01-01-1994
DG403A Benign myoklon epilepsi i barndommen 01-01-1994
DG403B Epilepsi med myoklone-astatiske anfald 01-01-1994
DG403C Børneabsenceepilepsi 01-01-1994
DG403D Epilepsi med myoklone absencer 01-01-1994
DG403E Juvenil absenceepilepsi 01-01-1994
DG403F Juvenil myoklon epilepsi 01-01-1994
DG403G Idiopat. gen. epilepsi kun m gen. tonisk-klonisk anfald,GTCS 01-01-1994
DG403H Epileptisk anfald, uspecifikt myoklonisk 01-01-1994 31-03-2006
DG403I Epileptisk anfald, uspecifikt atonisk 01-01-1994 31-03-2006
DG403J Epileptisk anfald, uspecifikt tonisk-klonisk 01-01-1994 31-03-2006
DG403K Epileptisk anfald, uspecifikt tonisk 01-01-1994 31-03-2006
DG403L Epileptiske absencer hos børn 01-01-1994 31-03-2006
DG403M Hypsarrhytmia 01-01-1994 31-03-2006
DG403N Petit mal, juvenil 01-01-1994 31-03-2006
DG403O Pyknolepsia 01-01-1994 31-03-2006
DG403P Neonatale anfald 01-01-2012
DG404 Epileptisk encefalopati 01-01-1994
DG404A Tidlig myoklonusencefalopati 01-01-1994
DG404B Ohtahara syndrom 01-01-1994
DG404C Infantile spasmer 01-01-1994
DG404D Svær myoklon epilepsi i barndommen 01-01-1994
DG404E Lennox-Gastaut's syndrom (LGS) 01-01-1994
DG404F Landau-Kleffner 01-01-1994 31-12-2011
DG404G Epilepsi med kontinuerlige spike waves under slow wave søvn 01-01-2006 31-12-2011
DG404H Rasmussens syndrom 01-01-2006
DG405 Specielt epileptisk syndrom 01-01-1994
DG405A Neonatale anfald 01-01-1994 31-12-2011
DG405B Reflexepilepsier 01-01-1994 31-12-2011
DG405C Epilepsia hormonalis 01-01-1994 31-03-2006
DG405D Epilepsia partialis continua 01-01-1994 31-03-2006
DG405E Epilepsia, forårsaget af søvnløshed 01-01-1994 31-03-2006
DG405F Epilepsia, forårsaget af belastning (stress) 01-01-1994 31-03-2006
DG405G Kojewnikow syndrom 01-01-1994 31-03-2006
DG405H Status epilepticus, fokal motorisk 01-01-1994 31-03-2006
DG405J Søvnrelateret epilepsi 01-04-2006 31-12-2011
DG405K Epilepsia partialis continua 01-01-2012
DG405L Epilepsi med kontinuerlige spike waves under slow wave søvn 01-01-2012
DG406 Generaliseret tonisk-klonisk anfald UNS 01-01-1994
DG407 Abscenser uden grand mal anfald 01-01-1994
DG408 Anden epilepsi 01-01-1994
DG408A Refleksepilepsier 01-01-2012
DG408B Søvnrelateret epilepsi 01-01-2012
DG409 Epilepsi UNS 01-01-1994
DG409A Uspecificeret epilepsi med GTCS 01-01-2006 31-12-2011
DG41 Status epilepticus 01-01-1994
DG410 Generaliseret tonisk-klonisk status epilepticus 01-01-1994
DG410A Status epilepticus, grand mal 01-01-1994 31-12-2005
DG411 Non-konvulsivt status epilepticus af absencetype 01-01-1994
DG411A Status epilepticus psychomotoricus 01-01-1994 31-12-2005
DG412 Non-konvulsivt komplekst partielt status epilepticus 01-01-1994
DG418 Anden form for status epilepticus 01-01-1994
DG418A Coma epilepticum 01-01-1994 31-12-2005
DG419 Status epilepticus UNS 01-01-1994
DG43 Migræne 01-01-1994
DG430 Migræne uden aura 01-01-1994
DG430A Hemicrania, atypisk 01-01-1994 31-12-2011
DG431 Migræne med aura 01-01-1994
DG431A Aura uden hovedpine 01-01-1994
DG431B Migræne-ekvivalenter 01-01-1994
DG431C Hemicrania hemiplegica familiaris 01-01-1994
DG432 Status migrainosus 01-01-1994
DG433 Migræne med komplikation 01-01-1994
DG433A Migræne med cerebralt infarkt 01-01-1994
DG433B Migræne med hemiplegi 01-01-1994
DG438 Anden form for migræne 01-01-1994
DG438A Hemicrania ophthalmoplegica 01-01-1994
DG438B Hemicrania retinalis 01-01-1994
DG438C Atypisk migræne 01-01-2012
DG439 Migræne UNS 01-01-1994
DG44 Andre hovedpinesyndromer 01-01-1994
DG440 Hortons hovedpine 01-01-1994
DG440A Episodisk klyngehovedpine 01-01-1994
DG440B Kronisk paroksysmal hemikrani 01-01-1994
DG440C Cluster hovedpine 01-01-1994 01-09-1995
DG440D Hemicrania neuralgiformis periodica 01-01-1994 01-09-1995
DG440E Hemicrania paroxysmatica chronica 01-01-1994 01-09-1995
DG441 Vaskulær hovedpine IKA 01-01-1994
DG442 Spændingshovedpine 01-01-1994
DG443 Kronisk posttraumatisk hovedpine 01-01-1994
DG444 Hovedpine forårsaget af lægemiddel IKA 01-01-1994
DG448 Andet hovedpinesyndrom 01-01-1994
DG45 Transitorisk cerebral iskæmi og beslægtede syndromer 01-01-1994
DG450 Vertebrobasilært syndrom 01-01-1994
DG450A Arteria vertebralis-syndrom 01-01-1994
DG450B Arteria basilaris-syndrom 01-01-1994
DG451 Arteria carotis-syndrom 01-01-1994
DG452 Insufficiens af fl. el. dobbeltsidige præcerebrale arterier 01-01-1994
DG452A Insufficiens af dobbeltsidige præcerebrale arterier 01-01-1994
DG453 Amaurosis fugax 01-01-1994
DG454 Global forbigående amnesi 01-01-1994
DG458 Anden transitorisk cerebral iskæmi eller beslægtet syndrom 01-01-1994
DG459 Transitorisk anfald af cerebral iskæmi UNS 01-01-1994
DG459A Spasme i cerebral arterie 01-01-1994
DG46 Symptomkomplekser ved cerebrovaskulære sygdomme 01-01-1994
DG460 Arteria cerebri media-syndrom 01-01-1994
DG461 Arteria cerebri anterior-syndrom 01-01-1994
DG462 Arteria cerebri posterior-syndrom 01-01-1994
DG463 Cerebrovaskulært hjernestammesyndrom 01-01-1994
DG463A Benedikts syndrom 01-01-1994
DG463B Claudes syndrom 01-01-1994
DG463C Fovilles syndrom 01-01-1994
DG463D Millard-Gublers syndrom 01-01-1994
DG463E Wallenbergs syndrom 01-01-1994
DG463F Webers syndrom 01-01-1994
DG464 Cerebrovaskulært cerebellart syndrom 01-01-1994
DG465 Isoleret motorisk lakunært syndrom 01-01-1994
DG465A Hjernestammeapopleksi 01-01-1994 31-12-2011
DG466 Isoleret sensorisk lakunært syndrom 01-01-1994
DG467 Andet lakunært syndrom 01-01-1994
DG468 Andet vaskulært syndrom ved cerebrovaskulær sygdom 01-01-1994
DG47 Søvnforstyrrelser 01-01-1994
DG470 Insomni 01-01-1994
DG4700 Fysiologisk insomni 01-04-2006
DG4702 Insomni forårsaget af lægemiddel eller andet aktivt stof 01-04-2006
DG4703 Insomni forårsaget af sygdom klassificeret andetsteds 01-04-2006
DG471 Hypersomni 01-01-1994
DG4710 Organisk hypersomni UNS 01-04-2006
DG4711 Periodisk hypersomni 01-04-2006
DG4712 Idiopatisk hypersomni med lang søvntid 01-04-2006
DG4713 Idiopatisk hypersomni uden lang søvntid 01-04-2006
DG4714 Hypersomni betinget af lægemiddel eller andet aktivt stof 01-04-2006
DG4715 Hypersomni betinget af sygdom KA 01-04-2006
DG472 Forstyrret søvnrytme 01-01-1994
DG4720 Forstyrret søvnrytme UNS 01-04-2006
DG4721 Forstyrret søvnrytme pga forsinket søvnfase 01-04-2006
DG4722 Forstyrret søvnrytme pga tidlig søvnfase 01-04-2006
DG4723 Forstyrret søvnrytme pga uregelmæssig søvnfase 01-04-2006
DG4724 Forstyrret søvnrytme pga frit løbende søvnfase 01-04-2006
DG4725 An. tilst. m forstyrret søvnrytme pga lægem./an. aktivt stof 01-04-2006
DG4726 Forstyrret søvnrytme pga sygd. KA 01-04-2006
DG473 Søvnapnø 01-01-1994
DG4730 Søvnapnø ved søvnrelateret respirationsygdom UNS 01-04-2006
DG4731 Primær central søvnapnø 01-04-2006
DG4732 Obstruktiv søvnapnø 01-04-2006
DG4734 Idiopatisk søvnrelateret ikke-obstruktiv hypoventilation 01-04-2006
DG4735 Søvnrelateret hypoventilation/hypoxæmi pga. medicinsk sygdom 01-04-2006
DG4735A Søvnrelateret hypovent./hypoxæmi pga. lunge- eller karsygdom 01-04-2006
DG4735B Søvnrel. hypoventilation/hypoxæmi v nedre luftvejsobstruktio 01-04-2006
DG4735C Søvnrel. hypoventilation/hypoxæmi v neuro/sygdom i brystvæg 01-04-2006
DG4735D Søvnrelateret hypoventilation/hypoxæmi pga. sygdom i CNS 01-04-2006
DG4735E Kongenit centralt hypoventilationssyndrom 01-04-2006
DG4736 Central apnø forårsaget af lægemiddel 01-04-2006
DG4739 An. central apnø pga sygd. KA 01-04-2006
DG474 Narkolepsi og katapleksi 01-01-1994
DG474A Cataplexia 01-01-1994 31-03-2006
DG474B Narcolepsia 01-01-1994 31-03-2006
DG4741 Narkolepsi med katapleksi 01-04-2006
DG4742 Narkolepsi uden katapleksi 01-04-2006
DG4743 Narkolepsi udløst af sygdom KA 01-04-2006
DG4744 Narkolepsi UNS 01-04-2006
DG475 Parasomni UNS 01-04-2006
DG475A Parasomni hyppigt associeret med REM søvn 01-04-2006
DG475B Parasomni hyppigt associeret med NREM søvn 01-04-2006
DG475W Anden parasomni 01-04-2006
DG4750 Parasomni, uspecificeret 01-04-2006 31-12-2011
DG4751 Natlig konfusion (søvndrukken) 01-04-2006
DG4752 Adfærdssyndrom ved REM-søvn (RBD) 01-04-2006
DG4753 Søvnparalyse 01-04-2006
DG4754 Parasomni på grund af lægemiddel eller substans 01-04-2006
DG4755 Parasomni pga medicinsk sygdom 01-04-2006
DG4756 Catathrenia 01-04-2006
DG4757 Exploding head syndrome 01-04-2006
DG4759 Søvn-relateret overspisning 01-04-2006
DG476 Søvnrelateret bevægesygdom 01-04-2006
DG4760 Søvnrelateret rytmisk bevægeforstyrrelse UNS 01-04-2006
DG4761 Rastløse ben 01-04-2006
DG4762 Periodisk bevægelser i ekstremiteterne 01-04-2006
DG4763 Søvnrelaterede benkramper 01-04-2006
DG4764 Tænderskæren 01-04-2006
DG4765 Søvnrelateret rytmisk bevægeforstyrrelse 01-04-2006
DG4766 Søvnrel. rytmisk bevægeforstyrrelse sfa lægemidd/substans 01-04-2006
DG4767 Søvnrel. rytmisk bevægeforstyrrelse sfa medicinsk sygd 01-04-2006
DG478 Anden form for søvnforstyrrelse 01-01-1994
DG478A Periodisk hypersomni 01-01-1994 30-09-2016
DG478B Menstruationsrelateret hypersomni 01-04-2006
DG479 Søvnforstyrrelse UNS 01-01-1994
DG479A Søvnbesvær uden specifikation 01-04-2006 31-12-2011
DG50 Sygdomme i ansigtets følenerve 01-01-1994
DG500 Trigeminusneuralgi 01-01-1994
DG500A Paroksysmatisk ansigtssmertesyndrom 01-01-1994
DG500B Neuralgia nervi supraorbitalis 01-01-1994
DG500C Neuritis nervi trigemini (V) 01-01-1994
DG500D Neuritis nervi supraorbitalis 01-01-1994
DG500E Tics douloureux 01-01-1994
DG501 Atypiske ansigtssmerter 01-01-1994
DG508 Anden sygdom i ansigtets følenerve 01-01-1994
DG509 Sygdom i ansigtets følenerve UNS 01-01-1994
DG509A Trigeminusneuralgi 01-01-1994 31-12-2011
DG51 Sygdomme i ansigtets bevægenerve 01-01-1994
DG510 Paralyse af ansigtets bevægenerve 01-01-1994
DG510A Bells paralysis 01-01-1994 31-12-2011
DG511 Ganglionitis geniculi 01-01-1994
DG512 Melkersson-Rosenthals syndrom 01-01-1994
DG513 Spasmus hemifacialis clonicus 01-01-1994
DG514 Myokymia facialis 01-01-1994
DG518 Anden sygdom i ansigtets bevægenerve 01-01-1994
DG518A Degeneratio nervi facialis 01-01-1994
DG518B Hemiatrophia nervi facialis 01-01-1994
DG518C Neuralgia nervi facialis (VII) 01-01-1994
DG518D Neuritis nervi facialis (VII) 01-01-1994
DG519 Sygdom i ansigtets bevægenerve UNS 01-01-1994
DG52 Sygdomme i andre kranienerver 01-01-1994
DG520 Sygdom i lugtenerven 01-01-1994
DG521 Sygdom i nervus glossopharyngeus (IX) 01-01-1994
DG521A Neuralgia nervi glossopharyngei 01-01-1994
DG522 Sygdom i nervus vagus (X) 01-01-1994
DG523 Sygdom i nervus hypoglossus (XII) 01-01-1994
DG527 Sygdom samtidigt i flere kranienerver 01-01-1994
DG528 Sygdom i anden kranienerve 01-01-1994
DG529 Sygdom i kranienerve UNS 01-01-1994
DG53 Forandringer i kranienerver ved sygdomme klas. andetsteds 01-01-1994
DG530 Parese af fl. kranienerver v. infekt. El. parasit. sygd. KA 01-01-1994
DG530A Ganglionitis geniculata postherpetica 01-01-1994
DG530B Neuralgia nervi trigemini (V) postherpetica 01-01-1994
DG530C Neuralgia cranialis postherpetica 01-01-1994
DG531 Paralyse af fl. kranienerver v infekt. el parasit. sygd. KA 01-01-1994
DG531A Paralysis nervi cranialis multiplex ved infektiøs sygdom 01-01-1994 31-12-2011
DG531B Paralysis nervi cranialis multiplex ved parasitær sygdom 01-01-1994 31-12-2011
DG532 Parese af flere kranienerver ved sarkoidose 01-01-1994
DG533 Parese af flere kranienerver ved neoplastisk sygdom 01-01-1994
DG538 Affektion af kranienerver ved anden sygdom klas. andetsteds 01-01-1994
DG54 Sygdomme i nerverødder og nerveplekser 01-01-1994
DG540 Lidelse i plexus brachialis 01-01-1994
DG540A Brachialisneuralgi 01-01-1994
DG540B Costa cervicalis-syndrom 01-01-1994
DG540C Skalenersyndrom 01-01-1994
DG541 Lidelse i plexus lumbosacralis 01-01-1994
DG542 Lidelse i cervikal nerverod IKA 01-01-1994
DG543 Lidelse i torakal nerverod IKA 01-01-1994
DG544 Lidelse i lumbal nerverod IKA 01-01-1994
DG545 Amyotrophia neuralgica 01-01-1994
DG545A Neuropathia brachialis 01-01-1994 31-12-2011
DG545B Parsonage-Aldren-Turner's syndrom 01-01-1994 31-12-2011
DG546 Fantomsyndrom med smerter 01-01-1994
DG547 Fantomsyndrom uden smerter 01-01-1994
DG547A Fantomsyndrom UNS 01-01-1994
DG548 Anden sygdom i nerverod eller nerveplexus 01-01-1994
DG549 Sygdom i nerverod eller nerveplexus UNS 01-01-1994
DG55 Kompression af nerverødder og nerveplekser ved sygdomme KA 01-01-1994
DG550 Kompression af nerverod/nerveplexus ved neoplastisk sygdom 01-01-1994
DG550A Kompression af nerveplexus ved neoplastisk sygdom 01-01-1994
DG550B Kompression af nerverod ved neoplastisk sygdom 01-01-1994
DG551 Kompres. af nerverod/nerveplexus v. diskuslid. i rygsøjlen 01-01-1994
DG551A Kompression af nerveplexus ved diskuslidelse i rygsøjlen 01-01-1994
DG551B Kompression af nerverod ved diskuslidelse i rygsøjlen 01-01-1994
DG552 Kompression af nerverod eller nerveplexus ved spondylose 01-01-1994
DG552A Kompression af nerveplexus ved spondylose 01-01-1994
DG552B Kompression af nerverod ved spondylose 01-01-1994
DG553 Kompression af nerverod el. nerveplexus ved anden ryglidelse 01-01-1994
DG558 Kompression af nerverod el. nerveplexus ved anden sygdom KA 01-01-1994
DG56 Mononeuropati i arm 01-01-1994
DG560 Karpaltunnelsyndrom 01-01-1994
DG561 Anden neuropati i nervus medianus 01-01-1994
DG562 Neuropati i nervus ulnaris 01-01-1994
DG562A Paralysis nervi ulnaris tarda 01-01-1994
DG563 Neuropati i nervus radialis 01-01-1994
DG564 Kausalgi i arm 01-01-1994
DG568 Anden mononeuropati i overekstremitet 01-01-1994
DG568A Interdigitalt neurom på overekstremitet 01-01-1994
DG569 Mononeuropati på overekstremitet UNS 01-01-1994
DG57 Mononeuropati i ben 01-01-1994
DG570 Neuropati i nervus ischiadicus 01-01-1994
DG571 Meralgia paraesthetica 01-01-1994
DG571A Laesio nervi cutanei femoris lateralis syndrom 01-01-1994
DG572 Neuropati i nervus femoralis 01-01-1994
DG573 Neuropati i nervus peronaeus 01-01-1994
DG574 Neuropati i nervus tibialis 01-01-1994
DG575 Tarsaltunnelsyndrom 01-01-1994
DG576 Neuropati i nervus plantaris 01-01-1994
DG576A Mortons metatarsalgia 01-01-1994
DG578 Anden mononeuropati på underekstremitet 01-01-1994
DG578A Interdigitalt neurom på underekstremitet 01-01-1994
DG579 Mononeuropati på underekstremitet UNS 01-01-1994
DG58 Andre mononeuropatier 01-01-1994
DG580 Interkostal neuropati 01-01-1994
DG587 Neuropati samtidigt i flere enkelte nerver 01-01-1994
DG588 Anden mononeuropati 01-01-1994
DG589 Mononeuropati UNS 01-01-1994
DG59 Mononeuropati ved sygdomme klassificeret andetsteds 01-01-1994
DG590 Diabetisk mononeuropati 01-01-1994
DG598 Mononeuropati ved anden sygdom klassificeret andetsteds 01-01-1994
DG60 Arvelige og idiopatiske neuropatier 01-01-1994
DG600 Arvelig motorisk-sensorisk neuropati 01-01-1994
DG600A Hypertrofisk peroneal muskelatrofi 01-01-1994
DG600B Neuropatisk muskelatrofi 01-01-1994
DG600C Axonal peroneal muskelatrofi 01-01-1994
DG600D Atrophia Charcot-Marie-Tooth 01-01-1994
DG600E Déjerine-Sottas sygdom 01-01-1994
DG600F Hypertrofisk neuropati i barndommen 01-01-1994
DG600G Arvelig motorisk-sensorisk neuropati, type I-IV 01-01-1994
DG600H Neuropathia, hereditær motorisk-sensorisk 01-01-1994 31-12-2011
DG600I Roussy-Lévys syndrom 01-01-1994
DG601 Refsums sygdom 01-01-1994
DG602 Neuropati ved ataxia hereditaria 01-01-1994
DG603 Idiopatisk progressiv neuropati 01-01-1994
DG608 Anden form for arvelig motorisk-sensorisk neuropati 01-01-1994
DG608A Morvans sygdom 01-01-1994
DG608B Nelatons syndrom 01-01-1994
DG608C Recessiv arvelig sensorisk neuropati 01-01-1994
DG608D Dominant arvelig sensorisk neuropati 01-01-1994
DG609 Arvelig eller idiopatisk neuropati UNS 01-01-1994
DG61 Inflammatoriske polyneuropatier 01-01-1994
DG610 Guillain-Barrés syndrom 01-01-1994
DG610A Polyneuropathia acuta (post) infectiosa 01-01-1994 31-12-2011
DG611 Serumneuropati 01-01-1994
DG618 Anden inflammatorisk polyneuropati 01-01-1994
DG619 Inflammatorisk polyneuropati UNS 01-01-1994
DG62 Andre polyneuropatier 01-01-1994
DG620 Polyneuropati forårsaget af lægemiddel 01-01-1994
DG621 Alkoholisk polyneuropati 01-01-1994
DG622 Polyneuropati forårsaget af andet toksisk agens 01-01-1994
DG628 Anden polyneuropati 01-01-1994
DG628A Strålingsudløst polyneuropati 01-01-1994
DG629 Polyneuropati UNS 01-01-1994
DG63 Polyneuropatier ved sygdomme klassificeret andetsteds 01-01-1994
DG630 Polyneuropati ved infektiøs eller parasitær sygdom KA 01-01-1994
DG630A Polyneuropathia ved infektiøs sygdom 01-01-1994 31-12-2011
DG630B Polyneuropathia tuberculosa 01-01-1994 31-12-2011
DG630C Polyneuropathia ved parasitær sygdom 01-01-1994 31-12-2011
DG630D Polyneuropathia, syphilis, sen 01-01-1994 31-12-2011
DG630E Polyneuropathia, syphilis, kongenit 01-01-1994 31-12-2011
DG630F Polyneuropathia, zoster 01-01-1994 31-12-2011
DG630G Polyneuropathia, diphtheritis 01-01-1994 31-12-2011
DG630H Polyneuropathia, lepra 01-01-1994 31-12-2011
DG630I Polyneuropathia, parotitis 01-01-1994 31-12-2011
DG630J Polyneuropathia, mononucleosis infectiosa 01-01-1994 31-12-2011
DG630K Polyneuropathia, Lyme's sygdom 01-01-1994 31-12-2011
DG631 Polyneuropati v. neoplastisk sygdom klassificeret andetsteds 01-01-1994
DG632 Diabetisk polyneuropati 01-01-1994
DG633 Polyneuropati ved anden endokrin eller metabolisk sygdom KA 01-01-1994
DG634 Polyneuropati ved underernæring klassificeret andetsteds 01-01-1994
DG635 Polyneuropati ved generaliseret bindevævssygdom KA 01-01-1994
DG636 Polyneuropati ved anden muskulosskeletal sygdom KA 01-01-1994
DG638 Polyneuropati ved anden sygdom klassificeret andetsteds 01-01-1994
DG638A Neuropathia uraemica 01-01-1994 31-12-2011
DG64 Andre sygdomme i det perifere nervesystem 01-01-1994
DG649 Anden sygdom i perifere nervesystem 01-01-1994
DG649A Sygdom i perifere nervesystem UNS 01-01-1994
DG70 Myasthenia gravis og andre neuromuskulære sygdomme 01-01-1994
DG700 Myasthenia gravis 01-01-1994
DG701 Toksisk neuromuskulær sygdom 01-01-1994
DG702 Medfødt og udviklingsrelateret myasteni 01-01-1994
DG708 Anden neuromuskulær sygdom 01-01-1994
DG709 Neuromuskulær sygdom UNS 01-01-1994
DG71 Primære muskelsygdomme 01-01-1994
DG710 Muskeldystrofi 01-01-1994
DG710A Dystrophia musculorum oculopharyngealis 01-01-1994
DG710B Dystrophia musculorum progressiva 01-01-1994
DG710C Dystrophia musculorum oculi 01-01-1994
DG710D Dystrophia musculorum typus limb-girdle 01-01-1994
DG710E Dystrophia musculorum scapuloperonealis 01-01-1994
DG710F Dystrophia musculorum progressiva hereditaria 01-01-1994
DG710G Dystrophia musculorum benigna 01-01-1994
DG710H Duchennes muskeldystrofi 01-01-1994
DG710I Dystrophia musculorum facioscapulohumeralis 01-01-1994
DG710J Dystrophia musculorum distalis 01-01-1994
DG711 Myoton sygdom 01-01-1994
DG711A Dystrophia myotonica 01-01-1994
DG711B Dominant myotonia congenita 01-01-1994
DG711C Recessiv myotonia congenita 01-01-1994
DG711D Myotonia congenita UNS 01-01-1994
DG711E Myotoni forårsaget af lægemiddel 01-01-1994
DG711F Myotonia symptomatica 01-01-1994
DG711G Myotonia chondrodystrophica 01-01-1994
DG711H Myotonia atrophica 01-01-1994 31-12-2011
DG711I Neuromyotonia 01-01-1994
DG711J Paramyotonia congenita 01-01-1994
DG711K Pseudomyotonia 01-01-1994
DG712 Medfødt myopati 01-01-1994
DG712A Medfødt muskeldystrofi UNS 01-01-1994
DG712B Medfødt flernukleær myopati 01-01-1994
DG712C Medfødt smånukleær myopati 01-01-1994
DG712D Medfødt centronukleær myopati 01-01-1994
DG712E Myopathia congenita, central core 01-01-1994 31-12-2011
DG713 Mitokondriel myopati IKA 01-01-1994
DG718 Anden primær muskelsygdom 01-01-1994
DG719 Primær muskelsygdom UNS 01-01-1994
DG72 Andre muskelsygdomme 01-01-1994
DG720 Myopati forårsaget af lægemiddel 01-01-1994
DG721 Alkoholisk myopati 01-01-1994
DG722 Myopati forårsaget af andet toksisk agens 01-01-1994
DG723 Paralysis periodica 01-01-1994
DG723A Hypokaliæmisk periodisk paralyse 01-01-1994
DG723B Hyperkaliæmisk periodisk paralyse 01-01-1994
DG723C Myoton periodisk paralyse 01-01-1994
DG723D Normokaliæmisk periodisk paralyse 01-01-1994
DG723E Paralysis periodica familiaris 01-01-1994 31-12-2011
DG724 Inflammatorisk myopati IKA 01-01-1994
DG728 Anden myopati 01-01-1994
DG729 Myopati UNS 01-01-1994
DG73 Neuromuskulære og muskulære sygdomme ved sygdomme KA 01-01-1994
DG730 Myastenisk syndrom ved endokrin sygdom 01-01-1994
DG730A Myastenisk syndrom ved amyotrophia diabetica 01-01-1994 31-12-2011
DG730B Myastenisk syndrom ved endokrin sygdom klass andetsteds 01-01-1994 31-12-2011
DG730C Myastenisk syndrom ved tyreotoksikose 01-01-1994 31-12-2011
DG731 Lambert-Eatons syndrom 01-01-1994
DG732 Andet myastenisk syndrom ved neoplastisk sygdom 01-01-1994
DG733 Myastenisk syndrom ved anden sygdom klassificeret andetsteds 01-01-1994
DG734 Myopati ved infektiøs el. parasitær sygdom klas. andetsteds 01-01-1994
DG734A Myopathia ved infektiøs sygdom 01-01-1994 31-12-2011
DG734B Myopathia ved parasitær sygdom 01-01-1994 31-12-2011
DG734C Inklusionslegeme myositis 01-04-2014
DG735 Myopati ved endokrin sygdom 01-01-1994
DG735A Myopathia thyrotoxica 01-01-1994 31-12-2011
DG735B Myopathia, hyperparathyroidismus 01-01-1994 31-12-2011
DG736 Myopati ved metabolisk sygdom 01-01-1994
DG736A Myopathia, glycogenose 01-01-1994 31-12-2011
DG736B Myopathia, lipidaflejringssygdomme 01-01-1994 31-12-2011
DG737 Myopati ved anden sygdom klassificeret andetsteds 01-01-1994
DG737A Myopathia, Sjögren's syndrom 01-01-1994 31-12-2011
DG737B Myopathia, sclerodermia 01-01-1994 31-12-2011
DG737C Myopathia, systemisk lupus erythematosus 01-01-1994 31-12-2011
DG737D Myopathia, arthritis rheumatoides 01-01-1994 31-12-2011
DG80 Cerebral parese 01-01-1994
DG800 Spastisk tetraplegisk cerebral parese 01-01-1994
DG801 Spastisk diplegisk cerebral parese 01-01-1994
DG802 Spastisk hemiplegisk cerebral parese 01-01-1994
DG803 Dyskinetisk cerebral parese 01-01-1994
DG803A Atetotisk cerebral parese 01-01-1994
DG803B Chorea cerebralis 01-01-1994
DG804 Ataktisk cerebral parese 01-01-1994
DG808 Anden form for cerebral parese 01-01-1994
DG808A Blandet syndrom ved cerebral parese 01-01-1994
DG809 Cerebral parese UNS 01-01-1994
DG809A Cerebral parese 01-01-1994 31-12-2011
DG81 Hemiplegi 01-01-1994
DG810 Slap hemiplegi 01-01-1994
DG811 Spastisk hemiplegi 01-01-1994
DG819 Hemiplegi UNS 01-01-1994
DG82 Paraplegi og tetraplegi 01-01-1994
DG820 Slap paraplegi 01-01-1994
DG821 Spastisk paraplegi 01-01-1994
DG822 Paraplegi UNS 01-01-1994
DG822A Paraparesis af underekstremiteter UNS 01-01-2012
DG823 Slap tetraplegi 01-01-1994
DG824 Spastisk tetraplegi 01-01-1994
DG825 Tetraplegi UNS 01-01-1994
DG83 Andre syndromer med lammelse 01-01-1994
DG830 Diplegi af overekstremiteter 01-01-1994
DG831 Monoplegi af underekstremitet 01-01-1994
DG831A Paraparesis, underekstremitet 01-01-1994 31-12-2011
DG832 Monoplegi af overekstremitet 01-01-1994
DG832A Paraparesis, overekstremitet 01-01-1994 31-12-2011
DG833 Monoplegi UNS 01-01-1994
DG834 Cauda equina-syndrom 01-01-1994
DG834A Neurogen urinblære ved cauda equina syndrom 01-01-1994
DG834B Neurogen claudicatio intermittens 01-01-2012
DG835 Locked-in-syndrom 01-01-2016
DG838 Andet paralytisk syndrom 01-01-1994
DG838A Paralysis postepileptica 01-01-1994
DG839 Paralytisk syndrom UNS 01-01-1994
DG839A Lammelse 01-01-2004 31-12-2011
DG90 Sygdomme i autonome nervesystem 01-01-1994
DG900 Idiopatisk perifer autonom neuropati 01-01-1994
DG900A Sinus caroticus-synkope 01-01-1994
DG901 Familiær dysautonomi 01-01-1994
DG901A Riley-Day's syndrom 01-01-1994 31-12-2011
DG902 Horners syndrom 01-01-1994
DG903 Multipel systemdegeneration i autonome nervesystem 01-01-1994 31-12-2015
DG903A Neurogen ortostatisk hypotension 01-01-1994 30-06-2016
DG903B Shy-Dragers syndrom 01-01-1994 30-06-2016
DG904 Autonom dysrefleksi 01-01-2012
DG908 Anden sygdom i autonome nervesystem 01-01-1994
DG909 Sygdom i autonome nervesystem UNS 01-01-1994
DG909A Neurogen ortostatisk hypotension 01-07-2016
DG909B Shy-Dragers syndrom 01-07-2016
DG91 Hydrocefalus 01-01-1994
DG910 Kommunikerende hydrocefalus 01-01-1994
DG911 Obstruktiv hydrocefalus 01-01-1994
DG912 Normaltrykshydrocefalus 01-01-1994
DG913 Posttraumatisk hydrocefalus UNS 01-01-1994
DG918 Anden form for hydrocefalus 01-01-1994
DG919 Hydrocefalus UNS 01-01-1994
DG92 Toksiske sygdomme i hjernen 01-01-1994
DG929 Toksisk encefalopati 01-01-1994
DG929A Malersyndrom 01-01-1994
DG93 Andre hjernesygdomme 01-01-1994
DG930 Hjernecyste 01-01-1994
DG930A Araknoidalcyste 01-01-1994
DG930B Erhvervet porencefalcyste 01-01-1994
DG931 Anoksisk hjerneskade IKA 01-01-1994
DG932 Benign intrakraniel trykforøgelse 01-01-1994
DG933 Postviralt træthedssyndrom 01-01-1994
DG933A Benign myalgisk encephalomyelitis 01-01-1994
DG934 Encefalopati UNS 01-01-1994
DG935 Compressio cerebri 01-01-1994
DG935A Hjernestammekompression 01-01-1994
DG935B Hjerneinkarceration 01-01-1994
DG935C Hjernestammeinkarceration 01-01-1994
DG936 Hjerneødem 01-01-1994
DG937 Reyes syndrom 01-01-1994
DG938 Anden hjernesygdom 01-01-1994
DG938A Strålingsudløst encefalopati 01-01-1994
DG939 Hjernesygdom UNS 01-01-1994
DG94 Andre hjernesygdomme ved sygdomme klassificeret andetsteds 01-01-1994
DG940 Hydrocefalus ved infektiøs eller parasitær sygdom KA 01-01-1994
DG940A Hydrocephalus ved infektiøs sygdom 01-01-1994 31-12-2011
DG940B Hydrocephalus ved parasitær sygdom 01-01-1994 31-12-2011
DG941 Hydrocefalus ved neoplastisk sygdom klassificeret andetsteds 01-01-1994
DG942 Hydrocefalus ved anden sygdom klassiificeret andetsteds 01-01-1994
DG943 Encefalopati i sygdom klassificeret andetsteds 01-01-2019
DG948 Anden hjernesygdom ved sygdom klassificeret andetsteds 01-01-1994
DG95 Andre sygdomme i rygmarven 01-01-1994
DG950 Syringomyeli eller syringobulbi 01-01-1994
DG950A Syringobulbi 01-01-1994
DG950B Syringomyeli 01-01-1994
DG951 Vaskulær myelopati 01-01-1994
DG951A Blødning i rygmarven 01-01-1994
DG951B Akut rygmarvsinfarkt 01-01-1994
DG951C Subakut nekrotiserende myelopati 01-01-1994
DG951D Rygmarvsødem 01-01-1994
DG951E Ikke-pyogen intraspinal flebitis 01-01-1994
DG951F Ikke-pyogen intraspinal tromboflebitis 01-01-1994
DG951G Arteriel trombose i rygmarven 01-01-1994
DG952 Rygmarvskompression UNS 01-01-1994
DG952A Medullært tværsnitssyndrom forårsaget af kompression 01-01-2002
DG958 Anden sygdom i rygmarv 01-01-1994
DG958A Strålingsudløst myelopati 01-01-1994
DG958B Myelopati forårsaget af lægemiddel 01-01-1994
DG958C Neurogen urinblære ved rygmarvsbeskadigelse 01-01-1994
DG959 Sygdom i rygmarven UNS 01-01-1994
DG96 Andre sygdomme i centralnervesystemet IKA 01-01-1994
DG960 Liquorrhoea cerebrospinalis 01-01-1994
DG960A Otoliquorrhea cerebrospinalis 01-01-1994
DG960B Rhinoliquorrhea cerebrospinalis 01-01-1994
DG961 Sygdom i meninges IKA 01-01-1994
DG961A Adhaesiones meningum 01-01-1994
DG968 Anden sygdom i centralnervesystemet 01-01-1994
DG969 Sygdom i centralnervesystemet UNS 01-01-1994
DG97 Sygdomme i nervesystemet som følge af indgreb IKA 01-01-1994
DG970 Liquorrhoea cerebrospinalis efter lumbalpunktur 01-01-1994
DG971 Anden reaktion efter spinal- eller lumbalpunktur 01-01-1994
DG972 Nedsat intrakranielt tryk ved ventrikulær shunt 01-01-1994
DG978 Anden sygdom i nervesystemet som følge af indgreb 01-01-1994
DG978A Hjerneanoksi som følge af indgreb 01-01-1994
DG979 Sygdom i nervesystemet som følge af indgreb UNS 01-01-1994
DG98 Andre sygdomme i nervesystemet IKA 01-01-1994
DG989 Anden sygdom i nervesystemet IKA 01-01-1994
DG99 Andre sygdomme i nervesystemet ved sygdomme klas. andetsteds 01-01-1994
DG990 Autonom neuropati ved endokrin eller metabolisk sygdom KA 01-01-1994
DG990A Neuropathia autonomica ved endokrin sygdom 01-01-1994 31-12-2011
DG990B Neuropathia autonomica amyloides 01-01-1994 31-12-2011
DG990C Neuropathia autonomica diabetica 01-01-1994 31-12-2011
DG991 Anden sygdom i det autonome nervesystem ved sygdom KA 01-01-1994
DG992 Myelopati ved sygdom klassificeret andetsteds 01-01-1994
DG992A Myelopathia, sygdom i discus intervertebralis 01-01-1994 31-12-2011
DG992B Myelopathia, sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DG992C Myelopathia, compressio arteriae spinalis anterior syndrom 01-01-1994 31-12-2011
DG992D Myelopathia, spondylosis 01-01-1994 31-12-2011
DG992E Myelopathia, neoplastisk sygdom 01-01-1994 31-12-2011
DG992F Myelopathia, compressio arteriae vertebralis syndrom 01-01-1994 31-12-2011
DG998 Anden sygdom i nervesystemet ved sygdom klas. andetsteds 01-01-1994
DH00 Hordeolum og chalazion 01-01-1994
DH000 Hordeolum og anden dyb betændelse i øjenlåg 01-01-1994
DH000A Absces i øjenlåg 01-01-1994
DH000B Furunkel i øjenlåg 01-01-1994
DH000C Bygkorn 01-01-1994
DH000D Flegmone i øjenlåg 01-01-1994
DH001 Chalazion 01-01-1994
DH01 Anden betændelse i øjenlåg 01-01-1994
DH010 Blefaritis 01-01-1994
DH011 Ikke-infektiøs dermatitis på øjenlåg 01-01-1994
DH011A Eksematøs dermatitis på øjenlåg 01-01-1994
DH011B Kontaktdermatitis på øjenlåg 01-01-1994
DH011C Allergisk dermatitis på øjenlåg 01-01-1994
DH011D Lupus erythematosus discoides palpebrae 01-01-1994
DH011E Xeroderma palpebrae 01-01-1994
DH018 Anden betændelse af øjenlåg 01-01-1994
DH019 Betændelse af øjenlåg UNS 01-01-1994
DH02 Andre sygdomme i øjenlåg 01-01-1994
DH020 Entropion eller trichiasis på øjenlåg 01-01-1994
DH020A Entropion palpebrae 01-01-1994
DH020B Trichiasis palpebrae 01-01-1994
DH021 Ectropion palpebrae 01-01-1994
DH022 Lagoftalmi 01-01-1994
DH023 Blefarokalasi 01-01-1994
DH024 Blefaroptose 01-01-1994
DH025 Anden forstyrrelse i funktion af øjenlåg 01-01-1994
DH025A Ankyloblepharon acquisitum 01-01-1994
DH025B Blefarofimose 01-01-1994
DH025C Blepharospasmer 01-01-1994 30-09-2000
DH025D Retractio palpebrae 01-01-1994
DH026 Xanthelasma palpebrae 01-01-1994
DH027 Anden degenerativ lidelse i øjenlåg eller periorbital region 01-01-1994
DH027A Chloasma palpebrae 01-01-1994
DH027B Madarosis palpebrae 01-01-1994
DH027C Vitiligo palpebrae 01-01-1994
DH028 Anden sygdom i øjenlåg 01-01-1994
DH028A Retineret fremmedlegeme i øjenlåg 01-01-1994
DH028B Dermatochalasis palpebrae 01-01-1994
DH028C Hypertrichosis palpebrae 01-01-1994
DH029 Sygdom i øjenlåg UNS 01-01-1994
DH03 Affektion af øjenlåg ved sygdomme klassificeret andetsteds 01-01-1994
DH030 Affektion af øjenlåg ved parasitær infestation KA 01-01-1994
DH030A Dermatitis palpebrae parasitica 01-01-1994 31-12-2011
DH030B Leishmaniasis palpebrae 01-01-1994 31-12-2011
DH030C Loiasis palpebrae 01-01-1994 31-12-2011
DH030D Onchocerciasis palpebrae 01-01-1994 31-12-2011
DH030E Phthiriasis palpebrae 01-01-1994 31-12-2011
DH031 Affektion af øjenlåg ved anden infektiøs sygdom KA 01-01-1994
DH031A Framboesia i øjelåg 01-01-1994 31-12-2011
DH031B Herpesvirusinfektion i øjelåg 01-01-1994 31-12-2011
DH031C Lepra i øjelåg 01-01-1994 31-12-2011
DH031D Molluscum contagiosum i øjelåg 01-01-1994 31-12-2011
DH031E Tuberkulose i øjelåg 01-01-1994 31-12-2011
DH031F Zoster i øjelåg 01-01-1994 31-12-2011
DH038 Affektion af øjenlåg ved anden sygdom klas. andetsteds 01-01-1994
DH038A Impetigo palpebrae 01-01-1994 31-12-2011
DH04 Sygdomme i tåreapparatet 01-01-1994
DH040 Betændelse i tårekirtel 01-01-1994
DH041 Anden sygdom i tårekirtel 01-01-1994
DH041A Atrofi af tårekirtel 01-01-1994
DH041B Cyste i tårekirtel 01-01-1994
DH041C Dacryocystectasia 01-01-1994
DH041D Dacryocystocele 01-01-1994
DH041E Dacryops 01-01-1994
DH041F Xerophthalmus 01-01-1994
DH042 Epifora 01-01-1994
DH043 Akut eller ikke specificeret betændelse i tåreveje 01-01-1994
DH043A Akut betændelse i tårekanal 01-01-1994
DH043B Betændelse i tårekanal UNS 01-01-1994
DH043C Akut betændelse i tåresæk 01-01-1994
DH043D Betændelse i tåresæk UNS 01-01-1994
DH043E Dacryopericystitis acuta 01-01-1994
DH043F Dacryopericystitis UNS 01-01-1994
DH044 Kronisk betændelse i tåreapparat 01-01-1994
DH044A Kronisk betændelse i tårekanal 01-01-1994
DH044B Dacryodochitis chronica 01-01-1994 31-12-2011
DH044C Mucocele lacrimalis 01-01-1994
DH045 Stenose eller insufficiens i tåreveje 01-01-1994
DH045A Dacryolithiasis 01-01-1994
DH045B Eversio puncti lacrimalis 01-01-1994
DH045C Stenosis viarum lacrimalium 01-01-1994
DH045D Stenosis ducti nasolacrimalis 01-01-1994
DH045E Stenosis sacci lacrimalis 01-01-1994
DH045F Stenosis canaliculi lacrimalis 01-01-1994
DH046 Anden forandring i tåreapparat 01-01-1994
DH046A Fistula lacrimalis 01-01-1994
DH048 Anden sygdom i tåreapparat 01-01-1994
DH049 Sygdom i tåreapparat UNS 01-01-1994
DH05 Sygdomme i øjenhule 01-01-1994
DH050 Akut betændelse i øjenhule 01-01-1994
DH050A Absces i øjenhule 01-01-1994
DH050B Cellulitis orbitae 01-01-1994
DH050C Osteomyelitis orbitae 01-01-1994
DH050D Periostitis orbitae 01-01-1994
DH050E Flegmone i øjenhule 01-01-1994
DH050F Tenonitis orbitae 01-01-1994
DH051 Kronisk betændelse i øjenhule 01-01-1994
DH051A Granulom i øjenhule 01-01-1994
DH052 Eksoftalmi 01-01-1994
DH052A Eksoftalmi forårsaget af blødning i øjenhule 01-01-1994
DH052B Eksoftalmi forårsaget af ødem i øjenhule 01-01-1994
DH053 Deformering af øjenhule 01-01-1994
DH053A Atrofi af øjenhule 01-01-1994
DH053B Dysostosis orbitae 01-01-1994
DH053C Dysplasia orbitae 01-01-1994 31-12-2011
DH053D Exostosis orbitae 01-01-1994
DH054 Enofthalmi 01-01-1994
DH055 Retineret fremmedlegeme i øjenhule 01-01-1994
DH055A Corpus alienum chronicum orbitae 01-01-1994 31-12-2011
DH055B Retrobulbært retineret fremmedlegeme i øjenhule 01-01-1994
DH058 Anden sygdom i øjenhule 01-01-1994
DH058A Cyste i øjenhule 01-01-1994
DH058B Myopati i ydre øjenmuskel 01-01-1994
DH059 Sygdom i øjenhule UNS 01-01-1994
DH06 Sygdomme i tåreapparat og øjenhule ved sygdomme KA 01-01-1994
DH060 Sygdom i tåreapparatet ved sygdom klassificeret andetsteds 01-01-1994
DH061 Parasitær infektion i øjenhule ved sygdom klas. andetsteds 01-01-1994
DH061A Echinococcus orbitae 01-01-1994 31-12-2011
DH061B Myiasis orbitae 01-01-1994 31-12-2011
DH062 Eksoftalmi ved struma 01-01-1994
DH063 Anden sygdom i øjenhule ved sygdom klassificeret andetsteds 01-01-1994
DH10 Betændelse i øjets bindehinde 01-01-1994
DH100 Mukopurulent konjunktivitis 01-01-1994
DH101 Akut allergisk konjunktivitis 01-01-1994
DH101A Conjunctivitis atopica acuta 01-01-1994 31-12-2011
DH102 Anden akut konjunktivitis 01-01-1994
DH102A Akut epidemisk konjunktivitis el. keratokonjunkt, adenovirus 01-04-2020
DH102B Akut medikament. induceret konjunktivitis el keratokonjunkt. 01-04-2020
DH102C Toksisk konjunktivitis eller keratokonjunktivitis 01-04-2020
DH103 Akut konjunktivitis UNS 01-01-1994
DH104 Kronisk konjunktivitis 01-01-1994
DH104A Kronisk allergisk konjunktivitis 01-01-1994
DH104A0 Helårs (perennial) konjunktivitis 01-04-2020
DH104A1 Vernal konjunktivitis eller keratokonjunktivitis 01-04-2020
DH104B Kronisk follikulær konjunktivitis 01-04-2020
DH104C Kronisk papillær konjunktivitis 01-04-2020
DH104D Kron. konjunkt. el keratokonjunkt. sicca u Sjögrens syndrom 01-04-2020
DH105 Blefarokonjunktivitis 01-01-1994
DH106 Cikatriciel konjunktivitis 01-04-2020
DH108 Anden form for konjunktivitis 01-01-1994
DH109 Konjunktivitis UNS 01-01-1994
DH11 Andre sygdomme i øjets bindehinde 01-01-1994
DH110 Pterygium 01-01-1994
DH111 Degeneration af og aflejring i konjunktiva 01-01-1994
DH111A Argyrosis conjunctivae 01-01-1994 31-03-2020
DH111B Forkalkning i konjunktiva 01-01-1994
DH111C Degeneration af konjunktiva 01-01-1994
DH111D Pigmentering af konjunktiva 01-01-1994
DH111E Tørhed af conjunctiva 01-01-1994 31-03-2020
DH111F Pingueculum 01-04-2020
DH111G Degeneration af eller aflejring i konjunktiva UNS 01-04-2020
DH112 Ardannelse i konjunktiva 01-01-1994
DH112A Symblepharon 01-01-1994
DH113 Blødning i konjunktiva 01-01-1994
DH113A Subkonjunktival blødning 01-01-1994
DH114 Anden vaskulær lidelse eller cyste i konjunktiva 01-01-1994
DH114A Aneurisme i konjunktiva 01-01-1994
DH114B Cyste i konjunktiva 01-01-1994
DH114C Hyperæmi af konjunktiva 01-01-1994
DH114D Ødem i konjunktiva (chemosis) 01-01-1994
DH118 Anden sygdom i konjunktiva 01-01-1994
DH118A Pseudopterygium 01-01-1994
DH119 Sygdom i konjunktiva UNS 01-01-1994
DH13 Sygdomme i øjets bindehinde ved sygdomme klas. andetsteds 01-01-1994
DH130 Filariasis i konjunktiva 01-01-1994
DH131 Konjunktivitis ved infektion eller parasitær sygdom KA 01-01-1994
DH131A Conjunctivitis gonococcica 01-01-1994 31-12-2011
DH131B Conjunctivitis haemorrhagica acuta 01-01-1994 31-12-2011
DH131C Conjunctivitis follicularis adenoviralis acuta 01-01-1994 31-12-2011
DH131D Conjunctivitis haemorrhagica epidemica 01-01-1994 31-12-2011
DH131E Conjunctivitis, Newcastle 01-01-1994 31-12-2011
DH131F Conjunctivitis ved infektiøs sygdom klassificeret andetsted 01-01-1994 31-12-2011
DH131G Conjunctivitis ved parasitær sygdom klassificeret andetsted 01-01-1994 31-12-2011
DH131H Conjunctivitis meningococcica 01-01-1994 31-12-2011
DH131I Conjunctivitis membranacea 01-01-1994 31-12-2011
DH131J Conjunctivitis herpetica 01-01-1994 31-12-2011
DH131K Conjunctivitis lignosa 01-01-1994 31-12-2011
DH131L Conjunctivitis diphtheritica pseudomembranacea 01-01-1994 31-12-2011
DH131M Conjunctivitis, zoster 01-01-1994 31-12-2011
DH131N Conjunctivitis, chlamydia 01-01-1994 31-12-2011
DH131O Conjunctivitis, acanthamoeba 01-01-1994 31-12-2011
DH132 Konjunktivitis ved anden sygdom klassificeret andetsteds 01-01-1994
DH133 Pemphigus oculi 01-01-1994
DH133A Pemphigus conjunctivae 01-01-1994 31-12-2011
DH134 Konjunktivitis eller keratokonjunktivitis v. anden sygdom KA 01-04-2020
DH134A Konjunktivitis el keratokonjunkt. sicca v. Sjögrens syndrom 01-04-2020
DH134B Konjunkt. el keratokonjunkt. sicca v graft versus host sygd. 01-04-2020
DH134C Konjunktivitis eller keratokonjunktivitis ved atopi 01-04-2020
DH134D Blefarokonjunkt. el blefarokeratokonjunkt. v. okulær rosacea 01-04-2020
DH138 Anden sygdom i konjunktiva v sygdom klassificeret andetsteds 01-01-1994
DH15 Sygdomme i sclera 01-01-1994
DH150 Betændelse i sclera 01-01-1994
DH151 Episcleritis 01-01-1994
DH158 Anden sygdom i sclera 01-01-1994
DH158A Ectasia sclerae 01-01-1994 31-12-2011
DH158B Staphyloma equatorialis 01-01-1994
DH159 Sygdom i sclera UNS 01-01-1994
DH16 Keratitis 01-01-1994
DH160 Sår i hornhinde 01-01-1994
DH160A Keratitis ulcerosa 01-01-1994 31-03-2020
DH160B Ulcus centrale corneae 01-01-1994
DH160C Ulcus corneae uden specifikation 01-01-1994 31-12-2011
DH160D Ulcus rodens corneae 01-01-1994 31-03-2020
DH160E Ulcus serpens corneae 01-01-1994 31-03-2020
DH160F Ulcus perforatum corneae 01-01-1994
DH160G Ulcus marginale corneae 01-01-1994
DH160G0 Perifer ulcerativc keratit 01-04-2020
DH160G1 Mooren's ulcus 01-04-2020
DH160H Ulcus corneae med hypopyon 01-01-1994
DH161 Ikke-infektiøs keratitis eller keratopati 01-01-1994
DH161A Keratitis stellata 01-01-1994 31-03-2020
DH161B Keratitis striata 01-01-1994 31-03-2020
DH161C Keratitis punctata superficialis 01-01-1994
DH161D Keratitis nummularis 01-01-1994 31-03-2020
DH161E Keratitis areolaris 01-01-1994 31-03-2020
DH161F Keratitis filamentosa 01-01-1994
DH161G Keratitis actinica 01-01-1994
DH161G0 Sneblindhed 01-01-2012
DH161G1 Svejserøjne 01-01-2012
DH161H Sneblindhed 01-01-1994 31-12-2011
DH161J Neurotrofisk keratopati 01-04-2020
DH161K Ekspositionskeratitis eller ekspositionskeratopati 01-04-2020
DH161M Anden specificeret ikke infektiøs keratitis eller keratopati 01-04-2020
DH161N Ikke infektiøs keratitis eller keratopati UNS 01-04-2020
DH162 Keratokonjunktivitis 01-01-1994
DH162A Keratokonjunktivitis phlyctaenularis 01-01-1994
DH162B Keratoconjunctivitis neurotrophica 01-01-1994 31-03-2020
DH163 Keratitis profunda interstitialis 01-01-1994
DH164 Pannus corneae 01-01-1994
DH165 Infektiøs keratitis 01-04-2020
DH165A Bakteriel keratitis 01-04-2020
DH165B Keratitis forårsaget af Herpes Simplex virus 01-04-2020
DH165B0 Keratitis dendritica 01-04-2020
DH165B1 Keratitis disciformis 01-04-2020
DH165B2 Endothelitis 01-04-2020
DH165C Keratitis som led i Herpes Zoster 01-04-2020
DH165D Keratitis forårsaget af Acanthamøba 01-04-2020
DH165E Keratitis forårsaget af gær- eller skimmelsvamp 01-04-2020
DH165F Anden specificeret mikrobiel keratitis 01-04-2020
DH165G Mikrobiel keratitis UNS 01-04-2020
DH168 Anden form for keratitis 01-01-1994
DH169 Keratitis UNS 01-01-1994
DH17 Ar og uklarheder i cornea 01-01-1994
DH170 Leukoma adhaerens 01-01-1994
DH171 Anden central opacitet i cornea 01-01-1994
DH178 Anden cicatrice eller opacitet i cornea 01-01-1994
DH178A Embryotoxon posterior 01-01-1994 31-12-2011
DH179 Cicatrice eller opacitet i cornea UNS 01-01-1994
DH18 Andre sygdomme i hornhinde 01-01-1994
DH180 Pigmentering eller aflejring i hornhinde 01-01-1994
DH180A Haematocornea 01-01-1994
DH180B Kayser-Fleischer ring 01-01-1994
DH180C Krukenbergs spindel 01-01-1994
DH180D Pigmentatio corneae 01-01-1994
DH180E Stählis pigmentlinje 01-01-1994
DH180F Anden specificeret aflejring i hornhinde 01-04-2020
DH180G Aflejring i hornhinde UNS 01-04-2020
DH181 Bulløs keratopati 01-01-1994
DH181A Bulløs keratopati efter kataraktoperation 01-04-2020
DH181B Bulløs keratopati sekundært til intraokulært implantat 01-04-2020
DH181C Bulløs keratopati sekundært til glaukom 01-04-2020
DH181D Bulløs keratopati sekundært til uveit 01-04-2020
DH181E Anden specificeret form for bulløs keratopati 01-04-2020
DH181F Bulløs keratopati UNS 01-04-2020
DH182 Anden form for ødem i hornhinde 01-01-1994
DH183 Forandringer i hornhindens membraner 01-01-1994
DH183A Haab'ske striae 01-01-1994
DH183B Hydrops corneae 01-01-1994
DH184 Hornhindedegeneration 01-01-1994
DH184A Arcus senilis 01-01-1994
DH184B Keratopatia bandularis 01-01-1994
DH184C Salzmann's nodulære degeneration 01-04-2020
DH184D Terrien's marginale degeneration 01-04-2020
DH184E Shagrinering af hornhinden (Crocodile shagreen) 01-04-2020
DH184F Lipid degeneration sekundært til karindvækst 01-04-2020
DH185 Familiær corneadystrofi 01-01-1994
DH185A Fuchs corneadystrofi 01-01-1994
DH185B Epitel basalmembran dystrofi 01-01-1994
DH185C Granulær dystrofi type 1 01-01-1994
DH185D Lattice dystrofi 01-01-1994
DH185E Makulær dystrofi 01-01-1994
DH185F Posterior polymorf dystrofi 01-04-2020
DH185G Anden specificeret familiær cornea dystrofi 01-04-2020
DH185H Famililær cornea dystrofi UNS 01-04-2020
DH186 Keratoconus 01-01-1994
DH187 Anden deformitet af hornhinde 01-01-1994
DH187A Descemetocele 01-01-1994
DH187B Ectasia corneae 01-01-1994
DH187B0 Ectasia corneae efter refraktiv kirurgi 01-04-2020
DH187C Keratocele 01-01-1994 31-03-2020
DH187D Staphyloma corneae 01-01-1994
DH188 Anden sygdom i hornhinde 01-01-1994
DH188A Anaesthesia corneae 01-01-1994
DH188B Erosio recidivans corneae 01-01-1994
DH188C Hypaesthesia corneae 01-01-1994
DH189 Sygdom i hornhinde UNS 01-01-1994
DH19 Sygdomme i øjets senehinde og hornhinde ved sygdomme KA 01-01-1994
DH190 Skleritis eller episkleritis ved sygdom KA 01-01-1994
DH190A Episcleritis syphilitica 01-01-1994 31-12-2011
DH190B Episkleritis ved sygdom klassificeret andetsteds 01-01-1994
DH190C Episcleritis tuberculosa 01-01-1994 31-12-2011
DH190D Scleritis, zoster 01-01-1994 31-12-2011
DH190E Skleritis ved sygdom klassificeret andetsteds 01-01-1994
DH191 Keratitis el. keratokonjunktivitis f.a. Herpes simplex-virus 01-01-1994 31-03-2020
DH191A Keratitis dendritica 01-01-1994 31-03-2020
DH191B Keratitis herpetica 01-01-1994 31-12-2011
DH191C Keratitis disciformis 01-01-1994 31-03-2020
DH191D Keratoconjunctivitis herpetica 01-01-1994 31-12-2011
DH192 Keratit/keratokonjunkt. V. an. infekt. el parasit. sygd. KA 01-01-1994
DH192A Keratitis (interstitialis), acanthamoebiasis 01-01-1994 31-12-2011
DH192B Keratitis (interstitialis), morbilli 01-01-1994 31-12-2011
DH192C Keratitis (interstitialis) syphilitica 01-01-1994 31-12-2011
DH192D Keratitis (interstitialis), zoster 01-01-1994 31-12-2011
DH192E Keratitis (interstitialis) tuberculosa 01-01-1994 31-12-2011
DH192F Keratoconjunctivitis (interstitialis), acanthamoebiasis 01-01-1994 31-12-2011
DH192G Keratoconjunctivitis (interstitialis) tuberculosa 01-01-1994 31-12-2011
DH192H Keratoconjunctivitis (interstitialis) syphilitica 01-01-1994 31-12-2011
DH192I Keratoconjunctivitis (interstitialis), morbilli 01-01-1994 31-12-2011
DH192J Keratoconjunctivitis (interstitialis), zoster 01-01-1994 31-12-2011
DH192K Keratoconjunctivitis epidemica 01-01-1994 31-12-2011
DH192L Keratitis ved infektøs eller parasitær sygdom KA 01-01-2012 31-03-2020
DH192M Keratokonjunktivitis ved infektøs eller parasitær sygdom KA 01-01-2012 31-03-2020
DH193 Keratitis og keratokonjunktivitis ved anden sygdom KA 01-01-1994
DH193A Keratitis ved sygdom klassificeret andetsteds 01-01-1994 31-03-2020
DH193B Keratoconjunctivitis sicca 01-01-1994 31-12-2011
DH193C Keratokonjunctivitis ved sygdom klassificeret andetsteds 01-01-1994 31-03-2020
DH198 Anden sygdom i sclera eller cornea ved sygdom KA 01-01-1994
DH198A Keratoconusved Down's syndrom 01-01-1994 31-12-2011
DH20 Betændelse i regnbuehinde og strålelegeme 01-01-1994
DH200 Akut og subakut anterior uveitis 01-01-1994
DH200A Cyclitis subacuta 01-01-1994 31-07-2018
DH200B Cyclitis recidivans 01-01-1994 31-07-2018
DH200C Cyclitis acuta 01-01-1994 31-07-2018
DH200D Iridocyclitis subacuta 01-01-1994 31-07-2018
DH200E Iridocyclitis acuta 01-01-1994 31-07-2018
DH200F Iritis acuta 01-01-1994 31-07-2018
DH200G Iritis subacuta 01-01-1994 31-07-2018
DH200H Iritis recidivans 01-01-1994 31-07-2018
DH200I Uveitis anterior acuta 01-01-1994 31-07-2018
DH200J Iridocyclitis recidivans 01-01-1994 31-07-2018
DH200K Uveitis anterior subacuta 01-01-1994 31-07-2018
DH201 Kronisk anterior uveitis 01-01-1994
DH202 Linseinduceret anterior uveitis 01-01-1994
DH202A Iridocyclitis phakolytica 01-01-1994 31-07-2018
DH208 Anden form for anterior uveitis 01-01-1994
DH209 Anterior uveitis UNS 01-01-1994
DH21 Andre sygdomme i regnbuehinde og strålelegeme 01-01-1994
DH210 Hyphaema 01-01-1994
DH211 Anden vaskulær forandring i iris og corpus ciliare 01-01-1994
DH211A Rubeosis iridis 01-01-1994
DH212 Degeneration af iris eller corpus ciliare 01-01-1994
DH212A Atrofi af iris 01-01-1994
DH212B Miotisk pupilcyste 01-01-1994
DH212C Degeneration af iris 01-01-1994
DH212D Degeneration af corpus ciliare 01-01-1994
DH212E Degeneratio iridis marginalis pupillae 01-01-1994
DH212F Degeneratio iridis pigmentosa 01-01-1994
DH212G Iridoschisis 01-01-1994
DH212H Iris translucens 01-01-1994
DH212I Pupilsømsatrofi 01-01-1994
DH213 Cyste i iris, corpus ciliare eller forreste øjenkammer 01-01-1994
DH213A Cyste i iris efter implantation 01-01-1994
DH213B Cyste i iris forårsaget af parasit 01-01-1994
DH213C Cystis iridis exudativa 01-01-1994
DH213D Iriscyste UNS 01-01-1994
DH213E Cyste i forreste øjenkammer UNS 01-01-1994
DH213F Cystis camerae anterioris exudativa 01-01-1994
DH213G Cyste i forreste øjenkammer efter implantation 01-01-1994
DH213H Cyste i corporis ciliare UNS 01-01-1994
DH213I Cystis corporis ciliaris exudativa 01-01-1994
DH213J Cyste i corporis ciliare forårsaget af parasit 01-01-1994
DH213K Cyste i corporis ciliare efter implantation 01-01-1994
DH213L Cyste i forreste øjenkammer forårsaget af parasit 01-01-1994
DH214 Pupilmembraner 01-01-1994
DH214A Iris bombé 01-01-1994
DH214B Occlusio pupillae 01-01-1994
DH215 Anden adhærence eller rift i iris og corpus ciliare 01-01-1994
DH215A Goniosynechia 01-01-1994
DH215B Iridodialysis 01-01-1994
DH215C Recessio anguli iridocornealis 01-01-1994
DH215D Synechiae iridis posteriores 01-01-1994
DH215E Synechiae iridis anteriores 01-01-1994
DH215F Synekkier i iris UNS 01-01-1994
DH218 Anden forandring i iris eller corpus ciliare 01-01-1994
DH219 Forandring i iris eller corpus ciliare UNS 01-01-1994
DH22 Sygdomme i regnbuehinde og strålelegeme ved sygdomme KA 01-01-1994
DH220 Iridocyklitis ved infektiøs eller parasitær sygdom KA 01-01-1994
DH220A Iridocyclitis ved parasitær sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DH220B Iridocyclitis ved infektiøs sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DH220C Iridocyclitis, zoster 01-01-1994 31-12-2011
DH220D Iridocyclitis gonococcica 01-01-1994 31-12-2011
DH220E Iridocyclitis herpetica 01-01-1994 31-12-2011
DH220F Iridocyclitis tuberculosa 01-01-1994 31-12-2011
DH220G Iridocyclitis syphilitica 01-01-1994 31-12-2011
DH221 Iridocyklitis ved anden sygdom klassificeret andetsteds 01-01-1994
DH221A Iridocyclitis,sarcoidosis 01-01-1994 31-12-2011
DH221B Iridocyclitis,spondylitisankylopoietica 01-01-1994 31-12-2011
DH228 Anden sygdom i iris eller corpus ciliare ved sygdom KA 01-01-1994
DH25 Aldersbetinget grå stær (>=50 år) 01-01-1994
DH250 Begyndende aldersbetinget grå stær 01-01-1994
DH250A Cataracta senilis punctata 01-01-1994 31-12-2019
DH250B Bagre polstær 01-01-1994
DH250C Cataracta senilis subcapsularis 01-01-1994 31-12-2019
DH250D Cataracta senilis corticalis 01-01-1994 31-12-2019
DH250E Forreste polstær 01-01-1994
DH250F Cataracta senilis incipiens 01-01-1994 31-12-2011
DH250G Cataracta senilis coronaria 01-01-1994 31-12-2019
DH251 Aldersbetinget nukleær grå stær 01-01-1994
DH251A Cataracta senilis brunescens 01-01-1994 31-12-2019
DH251B Cataracta senilis nuclearis sclerotica 01-01-1994 31-12-2019
DH252 Cataracta Morgagnii 01-01-1994 31-12-2019
DH252A Cataracta senilis hypermatura 01-01-1994 31-12-2011
DH258 Anden eller kombineret aldersbetinget grå stær 01-01-1994
DH259 Aldersbetinget grå stær (>=50 år) UNS 01-01-1994
DH26 Andre former for grå stær 01-01-1994
DH260 Grå stær hos småbørn, børn, unge og voksne 01-01-1994
DH260A Grå stær hos småbørn (<2 år) 01-01-1994
DH260B Grå stær hos børn og unge (2 år til <18 år) 01-01-1994
DH260C Grå stær hos yngre voksne (18 år til <50 år) 01-01-1994
DH261 Traumatisk grå stær 01-01-1994
DH262 Grå stær sekundært til anden øjensygdom 01-01-1994
DH262A Katarakt ved kronisk iridocyklitis 01-01-1994 31-12-2019
DH262B Subkapsulære glaukomflecken 01-01-1994 31-12-2019
DH263 Grå stær forårsaget af lægemiddel 01-01-1994
DH264 Efterstær 01-01-1994
DH264A Sömmerings ring 01-01-1994 31-12-2019
DH265 Kapsulophimosis 01-04-2020
DH268 Anden form for grå stær 01-01-1994
DH269 Grå stær UNS 01-01-1994
DH269A Svulmende grå stær 01-01-2020
DH27 Andre forandringer i øjets krystallinske linse 01-01-1994
DH270 Afaki 01-01-1994
DH271 Dislokation af øjets krystallinske linse 01-01-1994
DH271A Dislocatio lentis 01-01-1994 31-12-2011
DH271B Luksation af øjets krystallinske linse 01-01-1994 31-03-2020
DH271C Subluksation af øjets krystallinske linse 01-01-1994 31-03-2020
DH278 Anden forandring i øjets krystallinske linse 01-01-1994
DH278A Linserest efter grå stær operation 01-01-2020
DH279 Forandring i øjets krystallinske linse UNS 01-01-1994
DH28 Grå stær og andre sygdomme i øjets kr. linse ved sygdomme KA 01-01-1994
DH280 Diabetisk grå stær 01-01-1994
DH281 Grå stær ved endokrin, ernæringsbet. el metabolisk sygdom KA 01-01-1994
DH281A Cataracta, underernæring 01-01-1994 31-12-2011
DH281B Cataracta, dehydratio 01-01-1994 31-12-2011
DH281C Cataracta, hypoparathyroidismus 01-01-1994 31-12-2011
DH282 Grå stær ved anden sygdom klassificeret andetsteds 01-01-1994
DH288 Anden sygdom i øjets krystallinske linse ved sygdom KA 01-01-1994
DH30 Betændelse i øjets årehinde og nethinde 01-01-1994
DH300 Fokal posterior uveitis 01-01-1994
DH300A Chorioiditis focalis 01-01-1994 31-07-2018
DH300B Retinitis focalis 01-01-1994 31-07-2018
DH301 Dissemineret posterior uveitis 01-01-1994
DH301A Choroiditis disseminata 01-01-1994 31-07-2018
DH301B Retinitis disseminata 01-01-1994 31-07-2018
DH302 Intermediær uveitis 01-01-1994
DH308 Anden form for posterior uveitis 01-01-1994
DH308A Haradas sygdom 01-01-1994 31-07-2018
DH309 Posterior uveitis UNS 01-01-1994
DH31 Andre forandringer i øjets årehinde 01-01-1994
DH310 Korioretinale ar 01-01-1994
DH310A Ar i macula lutea 01-01-1994
DH310B Retinopathia solaris 01-01-1994
DH310C Årehinderuptur 01-01-1994 31-12-2011
DH311 Degeneratio chorioideae 01-01-1994
DH311A Atrophia chorioideae 01-01-1994
DH311B Sclerosis chorioideae 01-01-1994
DH312 Dystrophia choroidalis hereditaria 01-01-1994
DH312A Atrophia gyrata chorioideae 01-01-1994
DH312B Choroideremia 01-01-1994
DH312C Dystrophia choroideae peripapillaris 01-01-1994
DH312D Dystrophia choroideae areolaris 01-01-1994
DH312E Dystrophia choroideae generalisata 01-01-1994
DH312F Dystrophia choroideae centralis 01-01-1994
DH313 Blødning eller ruptur i årehinden 01-01-1994
DH313A Haemorrhagia chorioideae expulsiva 01-01-1994
DH313B Haemorrhagia chorioideae 01-01-1994
DH313C Koroidalruptur 01-01-1994
DH314 Koroidalløsning 01-01-1994
DH314A Amotio chorioideae 01-01-1994 31-12-2011
DH318 Anden forandring i årehinde 01-01-1994
DH319 Forandring i årehinde UNS 01-01-1994
DH32 Forandringer i øjets årehinde og nethinde ved sygdomme KA 01-01-1994
DH320 Korioretinitis ved infektiøs eller parasitær sygdom KA 01-01-1994
DH320A Chorioretinitis ved parasitær sygd klassificeret andetsteds 01-01-1994 31-12-2011
DH320B Chorioretinitis ved infektiøs sygd klassificeret andetsteds 01-01-1994 31-12-2011
DH320C Chorioretinitis syphilitica 01-01-1994 31-12-2011
DH320D Chorioretinitis toxoplasmotica 01-01-1994 31-12-2011
DH320E Chorioretinitis tuberculosa 01-01-1994 31-12-2011
DH328 Anden forandring i øjets årehinde og nethinde ved sygdom KA 01-01-1994
DH33 Nethindeløsning 01-01-1994
DH330 Nethindeløsning med ruptur 01-01-1994
DH330A Nethindeløsning med ruptur, uden PVR 01-01-1994
DH330A0 Nethindeløsning med ruptur, uden PVR, tilliggende makula 01-04-2015
DH330A1 Nethindeløsning med ruptur, uden PVR, afløst makula 01-04-2015
DH330B Nethindeløsning med ruptur, med PVR 01-04-2015
DH330B0 Nethindeløsning med ruptur, med PVR, tilliggende makula 01-04-2015
DH330B1 Nethindeløsning med ruptur, med PVR, afløst makula 01-04-2015
DH331 Retinoskise eller cyste i retina 01-01-1994
DH331A Cystis retinae 01-01-1994
DH331B Cystis orae serratae 01-01-1994
DH331C Cystis retina e parasitica UNS 01-01-1994
DH331D Pseudocystis retinae 01-01-1994
DH331E Retinoschisis 01-01-1994
DH332 Amotio retinae serosa 01-01-1994
DH332A Nethindeløsning uden ruptur 01-01-1994
DH332B Nethindeløsning UNS 01-01-1994 31-03-2015
DH333 Ruptur af retina uden løsning 01-01-1994
DH333A Foramen retinae sine amotione 01-01-1994
DH333B Operculum retinae sine amotione 01-01-1994
DH334 Amotio retinae tractionis 01-01-1994
DH334A Proliferativ vitreoretinopati med amotio retinae 01-01-1994
DH334B Diabetisk retinal traktionsamotio 01-10-2011
DH335 Anden form for nethindeløsning 01-01-1994
DH34 Okklusion af retinale blodkar 01-01-1994
DH340 Transitorisk okklusion af retinalarterie 01-01-1994
DH340A Ischaemia transitoria retinae 01-01-1994
DH341 Occlusio arteriae centralis retinae 01-01-1994
DH341A Embolia arteriae centralis retinae 01-01-1994
DH341B Thrombosis arteriae centralis retinae 01-01-1994
DH342 Anden form for okklusion af retinalarterie 01-01-1994
DH342A Kolesterolplaques i retina 01-01-1994
DH342B Microembolus retinae 01-01-1994
DH342C Occlusio arteriae retinae partialis 01-01-1994
DH348 Anden vaskulær okklusion i retina 01-01-1994
DH348A Occlusio venae retinae incipiens 01-01-1994
DH348B Occlusio venae retinae UNS 01-01-1994
DH348C Occlusio venae retinae partialis 01-01-1994
DH348D Occlusio venae centralis retinae 01-01-1994
DH348E Thrombosis venae retinae UNS 01-01-1994
DH348F Thrombosis venae centralis retinae 01-01-1994
DH349 Okklusion af retinalt blodkar UNS 01-01-1994
DH35 Andre forandringer i øjets nethinde 01-01-1994
DH350 Retinopati og angiopati i retina 01-01-1994
DH350A Angiopathia retinae 01-01-1994
DH350B Fundus hypertonicus 01-01-1994
DH350C Retinalt mikroaneurisme 01-01-1994
DH350D Neovascularisatio retinae 01-01-1994
DH350E Perivasculitis retinae 01-01-1994
DH350F Retinopathia exudativa 01-01-1994
DH350G Retinopathia gravidarum 01-01-1994
DH350H Hypertensiv retinopati 01-01-1994
DH350I Retinopati UNS 01-01-1994
DH350J Varices retinae 01-01-1994
DH350K Vasculitis retinae 01-01-1994
DH351 Præmaturitetsretinopati 01-01-1994
DH351A Retrolental fibroplasi 01-01-1994
DH352 Anden proliferativ retinopati 01-01-1994
DH352A Epiretinal fibrose 01-01-1994
DH353 Degeneratio maculae luteae et polus posterior retinae 01-01-1994
DH353A Cystis maculae luteae 01-01-1994
DH353B Degeneratio disciformis maculae luteae 01-01-1994
DH353C Degeneratio maculae luteae senilis 01-01-1994
DH353D Degeneratio polus posterior retinae 01-01-1994
DH353E Degeneratio maculae luteae 01-01-1994
DH353F Foramen maculae luteae 01-01-1994
DH353G Kuhnt-Junius degeneration 01-01-1994
DH353H Maculopathia toxica 01-01-1994
DH353J Våd aldersrelateret makuladegen. m. subretinal karnydannelse 01-07-2007
DH353K Våd aldersrelateret makuladegen. u subretinal karnydannelse 01-07-2007
DH353L Tør aldersrelateret makuladegeneration (AMD) 01-07-2007
DH353M Vitreomakulær traktion 01-10-2011
DH353N Lamellært makulært hul 01-10-2011
DH353P Makulære druser 01-01-2017
DH353Q Angioid striae 01-01-2017
DH354 Perifer retinal degeneration 01-01-1994
DH354A Degeneratio retinae palisadis 01-01-1994
DH354B Degeneratio retinae reticularis 01-01-1994
DH354C Degeneratio retinae latticis 01-01-1994
DH354D Degeneratio retinae microcystoidis 01-01-1994
DH355 Familiær retinadystrofi 01-01-1994
DH355A Dystrophia retinae albi punctata 01-01-1994
DH355B Dystrophia tapetoretinalis 01-01-1994
DH355C Dystrophia retinae vitelliformis 01-01-1994
DH355D Dystrophia vitreo retinalis 01-01-1994
DH355E Dystrophia retinae pigmentaria 01-01-1994
DH355F Stargardts sygdom 01-01-1994
DH356 Retinal blødning 01-01-1994
DH357 Separation af retinale lag 01-01-1994
DH357A Amotio epithelii pigmenti retinae 01-01-1994
DH357B Chorioretinopathia centralis serosa 01-01-1994
DH358 Anden forandring i nethinde 01-01-1994
DH358A Retinale druser 01-01-2017
DH359 Forandring i nethinde UNS 01-01-1994
DH36 Forandringer i øjets nethinde ved sygdomme klas. andetsteds 01-01-1994
DH360 Diabetisk retinopati UNS 01-01-1994
DH360A Retinopathia simplex IDDM 01-01-1999 31-12-2011
DH360B Retinopathia proliferativa IDDM 01-01-1999 31-12-2011
DH360C Retinopathia simplex NIDDM 01-01-1999 31-12-2011
DH360D Retinopathia proliferativa NIDDM 01-01-1999 31-12-2011
DH360E Maculopathia diabetica IDDM 01-01-1999 31-12-2011
DH360F Maculopathia diabetica NIDDM 01-01-1999 31-12-2011
DH360H Simpel diabetisk retinopati 01-01-2012
DH360J Proliferativ diabetisk retinopati 01-01-2012
DH360K Diabetisk makulopati 01-01-2012
DH368 Anden retinal forandring ved sygdom klassificeret andetsteds 01-01-1994
DH368A Dystrophia retinae, ved forstyrrelse i lipidmetabolismen 01-01-1994 31-12-2011
DH368B Retinopathia atherosclerotica 01-01-1994 31-12-2011
DH368C Retinopathia proliferativa, segl-celle 01-01-1994 31-12-2011
DH368D Retinopati ved anden sygdom klassificeret andetsteds 01-01-2012
DH368D1 Retinal dystrofi ved anden sygdom klassificeret andetsteds 01-01-2012
DH368D2 Proliferativ retinopati ved anden sygdom klas. andetsteds 01-01-2012
DH40 Glaukom 01-01-1994
DH400 Glaukom suspekt 01-01-1994
DH400A Okulær hypertension 01-01-2021
DH400B Suspekt vinkellukning 01-01-2021
DH400C Akut vinkellukning 01-01-2021
DH400D Suspekt papilekskavation 01-01-2021
DH400E Pseudoexfoliationssyndrom uden glaukom 01-01-2021
DH400F Pigmentdispersionssyndrom uden glaukom 01-01-2021
DH400G Okulær hypertension sekundært til øjeninflammation 01-04-2021
DH400H Okulær hypertension sekundært til anden øjensygdom 01-04-2021
DH400J Okulær hypertension sekundært til lægemiddel 01-04-2021
DH401 Primært åbenvinklet glaukom 01-01-1994
DH401A Normaltryksglaukom 01-01-1994
DH401B Glaucoma pigmentosum 01-01-1994 31-12-2020
DH401C Glaucoma chronicum simplex 01-01-1994 31-12-2020
DH401D Glaucoma pseudoexfoliativum 01-01-1994 31-12-2020
DH401E Glaucoma capsulocuticulare 01-01-1994 31-12-2020
DH401F Glaucoma hypotensivum 01-01-1994 31-12-2020
DH402 Primær lukketvinklet glaukom 01-01-1994
DH402A Glaucoma angulo-clauso chronicum 01-01-1994 31-03-2021
DH402B Glaucoma angulo-clauso intermittens 01-01-1994 31-03-2021
DH402C Glaucoma angulo-clauso acutum 01-01-1994 31-03-2021
DH402D Glaukom sekundært til akut vinkellukning 01-04-2021
DH403 Traumatisk glaukom 01-01-1994
DH404 Glaukom sekundært til øjeninflammation 01-01-1994
DH405 Glaukom sekundært til anden øjensygdom 01-01-1994
DH405A Glaukom sekundært til pseudoexfoliationssyndrom 01-04-2021
DH405B Glaukom sekundært til pigmentdispersionssyndrom 01-04-2021
DH405C Neovaskulært glaukom 01-07-2021
DH406 Glaukom forårsaget af lægemiddel 01-01-1994
DH408 Anden form for glaukom 01-01-1994
DH409 Glaukom UNS 01-01-1994
DH42 Grøn stær ved sygdomme klassificeret andetsteds 01-01-1994
DH420 Glaukom v. endokrin, ernæringsbet. el. metabolisk sygdom KA 01-01-1994
DH420A Glaucoma amyloidosum 01-01-1994 31-12-2011
DH420B Glaucoma ved endokrin sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DH420C Glaucoma ved stofskifte sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DH420D Glaucoma ved ernærings sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DH420E Glaucoma, Lowe's syndrom 01-01-1994 31-12-2011
DH428 Glaukom ved anden sygdom klassificeret andetsteds 01-01-1994
DH428A Glaucoma ved onchocerciasis 01-01-1994 31-12-2011
DH43 Forandringer i øjets glaslegeme 01-01-1994
DH430 Prolapsus corporis vitrei 01-01-1994
DH431 Blødning i øjets glaslegeme 01-01-1994
DH432 Krystallinske aflejringer i øjets glaslegeme 01-01-1994
DH433 Anden opacitet i øjets glaslegeme 01-01-1994
DH433A Membrani corpus vitreum 01-01-1994
DH438 Anden forandring i øjets glaslegeme 01-01-1994
DH438A Ablatio corporis vitrei 01-01-1994 31-10-2011
DH438B Amotio corporis vitrei 01-01-1994 31-10-2011
DH438C Degeneratio corporis vitrei 01-01-1994
DH438D Kollaps af øjets glaslegeme 01-10-2011
DH439 Forandring i øjets glaslegeme UNS 01-01-1994
DH44 Forandringer i øjeæblet 01-01-1994
DH440 Purulent endoftalmitis 01-01-1994
DH440A Absces i øjets glaslegeme 01-01-1994
DH440B Panoftalmitis 01-01-2012
DH441 Anden form for endoftalmitis 01-01-1994
DH441A Endoftalmitis forårsaget af parasit UNS 01-01-1994
DH441B Ophthalmia sympathica 01-01-1994
DH441C Ophthalmia nodosa 01-01-1994
DH441D Uveitis sympathica 01-01-1994
DH441E Panuveitis 01-04-2018
DH442 Degenerativ myopi 01-01-1994
DH443 Anden degenerativ forandring i øjeæble 01-01-1994
DH443A Chalcosis 01-01-1994
DH443B Siderosis oculi 01-01-1994
DH444 Nedsat intraokulært tryk 01-01-1994
DH445 Degenerationsforandring i øjeæble 01-01-1994
DH445A Atrophia bulbi oculi 01-01-1994 31-03-2021
DH445B Glaucoma absolutum 01-01-1994 31-03-2021
DH445C Phthisis bulbi 01-01-1994
DH446 Retineret intraokulært magnetisk fremmedlegeme 01-01-1994
DH446A Corpus alienum chronicum magneticum lentis 01-01-1994 31-12-2011
DH446B Corpus alienum chronicum magneticum iridis 01-01-1994 31-12-2011
DH446C Corpus alienum chronicum magneticum poli post bulbi oculi 01-01-1994 31-12-2011
DH446D Corpus alienum chronicum magneticum corporis ciliaris 01-01-1994 31-12-2011
DH446E Corpus alienum chronicum magneticum camerae anterioris 01-01-1994 31-12-2011
DH446F Corpus alienum chronicum magneticum corporis vitrei 01-01-1994 31-12-2011
DH447 Retineret intraokulært ikke-magnetisk fremmedlegeme 01-01-1994
DH447A Corpus alienum chronicum non-magneticum lentis 01-01-1994 31-12-2011
DH447B Corpus alienum chronicum non-magneticum iridis 01-01-1994 31-12-2011
DH447C Corpus alienum chronicum non-magneticum poli post bulb ocul 01-01-1994 31-12-2011
DH447D Corpus alienum chronicum non-magneticum corporis ciliaris 01-01-1994 31-12-2011
DH447E Corpus alienum chronicum non-magneticum camerae anterioris 01-01-1994 31-12-2011
DH447F Corpus alienum chronicum non-magneticum corporis vitrei 01-01-1994 31-12-2011
DH448 Anden forandring øjeæble 01-01-1994
DH448A Anophthalmus acquisitus 01-01-1994
DH448B Haemophthalmus 01-01-1994
DH448C Luxatio bulbi oculi 01-01-1994
DH448D Ikke-traumatisk orbitalt kompartmentsyndrom 01-04-2015
DH449 Forandring i øjeæble UNS 01-01-1994
DH45 Forandringer i øjets glaslegeme og øjeæble ved sygdomme KA 01-01-1994
DH450 Blødning i øjets glaslegeme ved sygdom klas. andetsteds 01-01-1994
DH451 Endoftalmitis ved sygdom klassificeret andetsteds 01-01-1994
DH451A Endophthalmitis, toxocariasis 01-01-1994 31-12-2011
DH451B Endophthalmitis, onchocerciasis 01-01-1994 31-12-2011
DH451C Endophthalmitis, cysticercosis 01-01-1994 31-12-2011
DH458 Anden forandring i øjets glaslegeme og øjeæble ved sygdom KA 01-01-1994
DH46 Inflammationer i synsnerve 01-01-1994
DH469 Inflammation i synsnerve UNS 01-01-1994
DH469A Neuritis nervi optici retrobulbaris 01-01-1994
DH469B Neuropathia optica non-ischaemica 01-01-1994
DH469C Papillitis retinae 01-01-1994
DH47 Andre forandringer i synsnerve og synsbaner 01-01-1994
DH470 Forandring i synsnerve IKA 01-01-1994
DH470A Kompression af synsnerven 01-01-1994
DH470B Haemorrhagia vaginae nervi optici 01-01-1994
DH470C Iskæmisk neuropati af synsnerven (AION) 01-01-1994
DH471 Ødem af discus nervi optici UNS 01-01-1994
DH471A Stasepapil 01-01-1994 31-12-2011
DH472 Optikusatrofi 01-01-1994
DH472A Pallor temporalis disci nervi optici 01-01-1994
DH473 Anden forandring i synsnervepapillen 01-01-1994
DH473A Druser i synsnervepapillen 01-01-1994
DH473B Pseudopapilødem 01-01-1994
DH474 Forandring i chiasma opticum 01-01-1994
DH475 Forandring i de øvrige synsbaner 01-01-1994
DH475A Disordo tracti optici 01-01-1994
DH475B Disordo corporis geniculati lateralis 01-01-1994
DH475C Disordo radiationis opticae 01-01-1994
DH476 Forandring i synsbarken 01-01-1994
DH477 Forandring i synsbane UNS 01-01-1994
DH48 Forandringer i synsnerve og synsbaner ved sygdomme KA 01-01-1994
DH480 Optikusatrofi ved sygdom klassificeret andetsteds 01-01-1994
DH480A Atrophia nervi optici syphilitica 01-01-1994 31-12-2011
DH481 Retrobulbær neuritis ved sygdom klassificeret andetsteds 01-01-1994
DH481A Neuritis nervi optici retrobulbaris syphilitica 01-01-1994 31-12-2011
DH481B Neuritis nervi optici retrobulbaris, sclerosisdisseminata 01-01-1994 31-12-2011
DH481C Neuritis nervi optici retrobulbaris meningococcica 01-01-1994 31-12-2011
DH488 Anden forandring i synsnerve og synsbaner ved sygdom KA 01-01-1994
DH49 Skelen ved lammelse af øjenmuskler 01-01-1994
DH490 Okulomotoriusparese 01-01-1994
DH491 Troklearisparese 01-01-1994
DH492 Abducensparese 01-01-1994
DH493 Total oftalmoplegi 01-01-1994
DH494 Progressiv ekstern oftalmoplegi 01-01-1994
DH498 Anden skelen forårsaget af lammelse 01-01-1994
DH498A Kearns-Sayres syndrom 01-01-1994
DH498B Ekstern oftalmoplegi UNS 01-01-1994
DH499 Skelen ved lammelse UNS 01-01-1994
DH50 Andre former for skelen 01-01-1994
DH500 Konvergent konkomiterende skelen 01-01-1994
DH500A Esotropia alternans 01-01-1994
DH500B Esotropia monocularis 01-01-1994
DH501 Divergent konkomiterende skelen 01-01-1994
DH501A Exotropia monocularis 01-01-1994
DH501B Exotropia alternans 01-01-1994
DH502 Vertikal skelen 01-01-1994
DH502A Hypertropia 01-01-2012
DH502B Hypotropia 01-01-2012
DH503 Heterotropia intermittens 01-01-1994
DH503A Esotropia intermittens monocularis 01-01-1994
DH503B Esotropia intermittens alternans 01-01-1994
DH503C Exotropia intermittens monocularis 01-07-2010
DH503D Exotropia intermittens alternans 01-07-2010
DH504 Anden eller ikke specificeret heterotropi 01-01-1994
DH504A Cyclotropi 01-01-1994
DH504B Heterotropi UNS 01-01-1994
DH504C Hypertropia 01-01-1994 31-12-2011
DH504D Hypotropia 01-01-1994 31-12-2011
DH504E Mikrotropi 01-01-1994
DH504F Monofiksationssyndrom 01-01-1994
DH504G Strabismus concomitans UNS 01-01-1994
DH505 Heterofori 01-01-1994
DH505A Esofori 01-01-1994
DH505B Eksofori 01-01-1994
DH505C Hyperphoria alternans 01-01-1994
DH506 Strabismus mechanicus 01-01-1994
DH506A Browns skede syndrom 01-01-1994
DH506B Skelen forårsaget af adhærencer 01-01-1994
DH508 Anden form for skelen 01-01-1994
DH508A Duanes syndrom 01-01-1994
DH509 Skelen UNS 01-01-1994
DH51 Andre forstyrrelser i samsynsfunktionen 01-01-1994
DH510 Konjugeret blikparese 01-01-1994
DH511 Konvergensforstyrrelse 01-01-1994
DH512 Internukleær oftalmoplegi 01-01-1994
DH518 Anden forstyrrelse i samsynsfunktionen 01-01-1994
DH519 Forstyrrelse i samsynsfunktionen UNS 01-01-1994
DH52 Forstyrrelser i refraktion og akkommodation 01-01-1994
DH520 Hypermetropi 01-01-1994
DH521 Myopi 01-01-1994
DH522 Astigmatisme 01-01-1994
DH522A Uregelmæssig astigmatisme 01-04-2020
DH523 Anisometropi eller aniseikoni 01-01-1994
DH523A Aniseikoni 01-01-1994
DH523B Anisometropi 01-01-1994
DH524 Presbyopia 01-01-1994
DH525 Akkommodationsforstyrrelse UNS 01-01-1994
DH525A Akkommodationsspasme 01-01-1994
DH525B Ophthalmoplegia interna (partialis) (totalis) 01-01-1994
DH526 Anden refraktionsanomali 01-01-1994
DH527 Refraktionsanomali UNS 01-01-1994
DH53 Synsforstyrrelser 01-01-1994
DH530 Amblyopia ex anopsia 01-01-1994
DH530A Amblyopia strabismica 01-01-1994
DH530B Amblyopia deprivationis 01-01-1994
DH530C Amblyopia anisometropica 01-01-1994
DH531 Subjektive synsforstyrrelser 01-01-1994
DH531A Asthenopia 01-01-1994
DH531B Dagblindhed 01-01-1994
DH531C Halovisus 01-01-1994
DH531D Metamorphopsia 01-01-1994
DH531E Nyctalopia 01-01-1994 31-12-2011
DH531F Photophobia 01-01-1994
DH531G Scotoma scintillans 01-01-1994
DH531H Pludseligt synstab 01-01-1994
DH532 Dobbeltsyn 01-01-1994
DH533 Andre forstyrrelser i det binokulære syn 01-01-1994
DH533A Synsfusion med defekt stereopsi 01-01-1994
DH533B Abnorm retinal korrespondance 01-01-1994
DH533C Suppression af binokulært syn 01-01-1994
DH533D Simultan visuel perception uden fusion 01-01-1994
DH534 Synsfeltsdefekter 01-01-1994
DH534A Anopsia quadrantis 01-01-1994
DH534B Forstørret blind plet 01-01-1994
DH534C Hemianopsia homonyma 01-01-1994
DH534D Hemianopsia heteronyma 01-01-1994
DH534E Scotoma annulare 01-01-1994
DH534F Scotoma Bjerrum 01-01-1994
DH534G Scotoma centrale 01-01-1994
DH534H Scotoma arcuatum 01-01-1994
DH534I Generel synsfeltsbegrænsning 01-01-1994
DH535 Farvesyns defekter 01-01-1994
DH535A Achromatopsia acquisita 01-01-1994
DH535B Deuteranomalia 01-01-1994
DH535C Deuteranopi 01-01-1994
DH535D Protanomalia 01-01-1994
DH535E Protanopia 01-01-1994
DH535F Tritanomalia 01-01-1994
DH535G Tritanopia 01-01-1994
DH535H Achromatopsia 01-01-2012
DH536 Natteblindhed 01-01-1994
DH538 Anden synsforstyrrelse 01-01-1994
DH539 Synsforstyrrelse UNS 01-01-1994
DH54 Blindhed og svagsyn 01-01-1994
DH540 Dobbeltsidig blindhed 01-01-1994
DH541 Svær synsnedsættelse på begge øjne 01-01-1994
DH542 Moderat synsnedsættelse på begge øjne 01-01-1994
DH543 Let eller ingen synsnedsættelse på begge øjne 01-01-1994
DH544 Blindhed på et øje 01-01-1994
DH545 Svær synsnedsættelse på eet øje 01-01-1994
DH546 Moderat synsnedsættelse på eet øje 01-01-1994
DH547 Synsnedsættelse UNS 01-01-1994
DH55 Nystagmus og andre abnorme øjenbevægelser 01-01-1994
DH559 Nystagmus UNS 01-01-1994
DH559A Nystagmus deprivatus 01-01-1994
DH559B Nystagmus latens 01-01-1994
DH559C Nystagmus dissociatus 01-01-1994
DH559D Nystagmus congenitus 01-01-1994
DH559X Abnorme øjenbevægelser UNS 01-01-2004
DH57 Andre abnorme tilstande i øje og øjenomgivelser 01-01-1994
DH570 Abnorm pupilfunktion 01-01-1994
DH570A Adies pupil 01-01-1994
DH571 Øjensmerter 01-01-1994
DH578 Anden abnorm tilstand i øje eller øjenomgivelser 01-01-1994
DH579 Abnorm tilstand i øje eller øjenomgivelser UNS 01-01-1994
DH58 Andre sygdomme i øje og øjenomgivelser ved sygdomme KA 01-01-1994
DH580 Abnorm pupilfunktion ved sygdom klassificeret andetsteds 01-01-1994
DH580A Argyll Robertson pupil 01-01-1994 31-12-2011
DH580B Robertson's symptom 01-01-1994 31-12-2011
DH581 Synsforstyrrelse ved sygdom klassificeret andetsteds 01-01-1994
DH588 Anden sygdom i øje ved sygdom klassificeret andetsteds 01-01-1994
DH588A Oculopathia syphilitica ikke klassificeret andetsteds 01-01-1994 31-12-2011
DH59 Forandringer i øje og øjenomgivelser efter indgreb IKA 01-01-1994
DH590 Bulløs keratopati ved afaki efter kataraktoperation 01-01-1994
DH598 Anden sygdom i øje eller øjenomgivelser efter indgreb 01-01-1994
DH598A Korioretinalt ar efter indgreb for nethindeløsning 01-01-1994
DH598B Postoperativ endoftalmi 01-01-2012
DH599 Forandring i øje eller øjenomgivelser efter indgreb UNS 01-01-1994
DH60 Betændelse i ydre øre 01-01-1994
DH600 Absces i ydre øre 01-01-1994
DH600A Absces i ydre øregang 01-01-1994
DH601 Flegmone i ydre øre 01-01-1994
DH601A Cellulitis auris externae 01-01-1994 31-12-2011
DH601B Flegmone i ydre øregang 01-01-1994
DH602 Malign ekstern otitis 01-01-1994
DH603 Anden form for ekstern infektiøs otitis 01-01-1994
DH603A Badeotitis 01-01-1994
DH603B Otitis externa haemorrhagica 01-01-1994
DH603C Otitis externa diffusa 01-01-1994
DH604 Kolesteatom i ydre øre 01-01-1994
DH604A Keratosis obturans meatus acustici externi 01-01-1994
DH605 Akut ikke-infektiøs ekstern otitis 01-01-1994
DH605A Eczema meatus acustici externi 01-01-1994 31-12-2011
DH605B Akut eksem i ydre øre 01-01-1994
DH605C Otitis externa acuta contacta 01-01-1994 31-12-2011
DH605D Otitis externa acuta chemicalis 01-01-1994 31-12-2011
DH605E Otitis externa acuta non infectiosa 01-01-1994 31-12-2011
DH605F Otitis externa acuta eczematosa 01-01-1994 31-12-2011
DH605G Otitis externa acuta reactiva 01-01-1994 31-12-2011
DH605H Otitis externa acuta uden specifikation 01-01-1994 31-12-2011
DH605I Otitis externa acuta actinica 01-01-1994 31-12-2011
DH608 Anden form for ekstern otitis 01-01-1994
DH608A Kronisk ekstern otitis UNS 01-01-1994
DH609 Ekstern otitis UNS 01-01-1994
DH61 Andre sygdomme i ydre øre 01-01-1994
DH610 Perikondritis i ydre øre 01-01-1994
DH610A Chondrodermatitis nodularis helicis 01-01-1994
DH610B Perichondritis pinnae 01-01-1994 31-12-2011
DH611 Ikke-infektiøs sygdom i øremusling 01-01-1994
DH611A Erhvervet misdannelse af øremusling 01-01-1994
DH612 Cerumen impactum 01-01-1994
DH612A Cerumen excessivum 01-01-1994
DH613 Erhvervet forsnævring af ydre øregang 01-01-1994
DH618 Anden sygdom i ydre øre 01-01-1994
DH618A Eksostose i ydre øregang 01-01-1994
DH619 Sygdom i ydre øre UNS 01-01-1994
DH62 Forandringer i ydre øre v. sygdomme klassificeret andetsteds 01-01-1994
DH620 Ekstern otitis ved bakteriel sygdom klassificeret andetsteds 01-01-1994
DH620A Otitis externa, erysipelas 01-01-1994 31-12-2011
DH621 Ekstern otitis ved virussygdom klassificeret andetsteds 01-01-1994
DH621A Otitis externa herpetica 01-01-1994 31-12-2011
DH621B Otitis externa, zoster 01-01-1994 31-12-2011
DH622 Ekstern otitis ved mykose klassificeret andetsteds 01-01-1994
DH622A Otitis externa, candidiasis 01-01-1994 31-12-2011
DH622B Otitis externa, aspergillosis 01-01-1994 31-12-2011
DH622C Otomycosis uden specifikation 01-01-1994 31-12-2011
DH623 Ekstern otitis ved anden infektiøs eller parasitær sygdom KA 01-01-1994
DH623A Otitis externa ved andre parasitær sygdom klass andetsteds 01-01-1994 31-12-2011
DH623B Otitis externa ved andre infektiøs sygdom klass andetsteds 01-01-1994 31-12-2011
DH624 Ekstern otitis ved anden sygdom klassificeret andetsteds 01-01-1994
DH624A Otitis externa, impetigo 01-01-1994 31-12-2011
DH628 Anden forandring i ydre øre ved sygdom klas. andetsteds 01-01-1994
DH65 Mellemørebetændelse uden pusdannelse 01-01-1994
DH650 Akut serøs mellemørebetændelse 01-01-1994
DH650A Otitis media secretorica subacuta 01-01-1994
DH650B Otitis media secretorica acuta 01-01-1994 31-12-2011
DH651 Anden form for akut mellemørebetændelse uden pusdannelse 01-01-1994
DH651A Otitis media subacuta sanguinosa 01-01-1994 31-12-2011
DH651B Otitis media subacuta seromucinosa 01-01-1994 31-12-2011
DH651C Akut mellemørebetændelse uden pusdannelse UNS 01-01-1994
DH651D Subakut mellemørebetændelse uden pusdannelse UNS 01-01-1994
DH651E Otitis media acuta seromucinosa 01-01-1994 31-12-2011
DH651F Otitis media acuta sanguinosa 01-01-1994 31-12-2011
DH651G Otitis media acuta mucinosa 01-01-1994 31-12-2011
DH652 Kronisk serøs mellemørebetændelse 01-01-1994
DH652A Otitis media secretorica chronica 01-01-1994 31-12-2011
DH653 Kronisk mucinøs mellemørebetændelse 01-01-1994
DH653A Otitis media chronica transudativa 01-01-1994 31-12-2011
DH653B Otitis media chronica secretoria 01-01-1994 31-12-2011
DH654 Anden form for kronisk mellemørebetændelse uden pusdannelse 01-01-1994
DH654A Otitis media chronica exudativa 01-01-1994 31-12-2011
DH654B Otitis media chronica seromucinosa 01-01-1994 31-12-2011
DH654C Kronisk mellemørebetændelse uden pusdannelse UNS 01-01-1994
DH659 Mellemørebetændelse uden pusdannelse UNS 01-01-1994
DH66 Purulent og ikke spec. mellemørebetændelse 01-01-1994
DH660 Akut purulent mellemørebetændelse 01-01-1994
DH660A Otitis media acuta perforata 01-07-2006
DH661 Kronisk purulent tubotympanisk mellemørebetændelse 01-01-1994
DH661A Otitis media purulenta chronica tubotympanica 01-01-1994 31-12-2011
DH662 Kronisk purulent attikoantral mellemørebetændelse 01-01-1994
DH663 Anden form for kronisk purulent mellemørebetændelse 01-01-1994
DH664 Purulent mellemørebetændelse UNS 01-01-1994
DH669 Mellemørebetændelse UNS 01-01-1994
DH67 Mellemørebetændelse ved sygdomme klassificeret andetsteds 01-01-1994
DH670 Mellemørebetændelse ved bakteriel sygdom klas. andetsteds 01-01-1994
DH670A Otitis media, scarlatina 01-01-1994 31-12-2011
DH670B Otitis media tuberculosa 01-01-1994 31-12-2011
DH671 Mellemørebetændelse ved virussygdom klassificeret andetsteds 01-01-1994
DH671A Otitis media, morbilli 01-01-1994 31-12-2011
DH671B Otitis media, influenza 01-01-1994 31-12-2011
DH678 Mellemørebetændelse v. anden sygdom klassificeret andetsteds 01-01-1994
DH68 Betændelse og tillukning af det eustakiske rør 01-01-1994
DH680 Otosalpingitis 01-01-1994
DH681 Tillukning af det eustakiske rør 01-01-1994
DH681A Stenosis tubae auditivae (Eustachii) 01-01-1994 31-12-2011
DH69 Andre sygdomme i det eustakiske rør 01-01-1994
DH690 Tuba auditiva patulosa 01-01-1994
DH698 Anden sygdom i det eustakiske rør 01-01-1994
DH699 Sygdom i det eustakiske rør UNS 01-01-1994
DH70 Mastoiditis og beslægtede sygdomme 01-01-1994
DH700 Akut mastoiditis 01-01-1994
DH700A Abscessus processus mastoidei 01-01-1994 31-12-2011
DH700B Empyema processus mastoidei 01-01-1994 31-12-2011
DH701 Kronisk mastoiditis 01-01-1994
DH701A Caries processus mastoidei 01-01-1994 31-12-2011
DH701B Fistula processus mastoidei 01-01-1994 31-12-2011
DH702 Petrositis 01-01-1994
DH708 Anden form for mastoiditis og beslægtede sygdom 01-01-1994
DH709 Mastoiditis UNS 01-01-1994
DH71 Kolesteatom i mellemøre 01-01-1994
DH719 Kolesteatom i mellemøre UNS 01-01-1994
DH719A Cholesteatoma tympani 01-01-1994 31-12-2011
DH719B Cholesteatoma recidivans cavi tympani 01-01-2000 31-12-2011
DH72 Perforation af trommehinde 01-01-1994
DH720 Central perforation af trommehinde 01-01-1994
DH720A Central perforation efter otit 01-01-2000 31-12-2011
DH721 Atticus-perforation af trommehinde 01-01-1994
DH721A Pars flaccida-perforation af trommehinde 01-01-1994
DH722 Anden form for marginal perforation af trommehinde 01-01-1994
DH728 Anden form for perforation af trommehinde 01-01-1994
DH728A Total perforation af trommehinde 01-01-1994
DH728B Multiple perforationer af trommehinde 01-01-1994
DH729 Perforation af trommehinde UNS 01-01-1994
DH73 Anden sygdom i trommehinde 01-01-1994
DH730 Akut trommehindebetændelse 01-01-1994
DH730A Bulløs trommehindebetændelse 01-01-1994
DH731 Kronisk trommehindebetændelse 01-01-1994
DH738 Anden sygdom i trommehinde 01-01-1994
DH738A Trommehinderetraktion 01-01-2012
DH739 Sygdom i trommehinde UNS 01-01-1994
DH74 Andre sygdomme i mellemøre og processus mastoideus 01-01-1994
DH740 Tympanosklerose 01-01-1994
DH741 Sammenvoksninger i mellemøret 01-01-1994
DH742 Luksation af øreknogler 01-01-1994
DH743 Anden erhvervet abnormitet i øreknogler 01-01-1994
DH743A Ankylosis ossiculae auditus 01-01-1994
DH743B Delvis destruktion af øreknogle 01-01-1994
DH744 Polyp i mellemøre 01-01-1994
DH748 Anden sygdom i mellemøre eller processus mastoideus 01-01-1994
DH748A Mellemøre, anden specificeret sygdom i 01-01-1994 31-12-2011
DH748B Processus mastoideus, anden specificeret sygdom i 01-01-1994 31-12-2011
DH748C Følgetilstand efter tidligere mellemørebetændelse 01-01-2005 31-12-2011
DH749 Sygdom i mellemøre eller processus mastoideus UNS 01-01-1994
DH75 An. sygd. i mellemøre og processus mastoideus v. sygdomme KA 01-01-1994
DH750 Mastoiditis ved infektiøs eller parasitær sygdom KA 01-01-1994
DH750A Mastoiditis ved parasitær sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DH750B Mastoiditis ved infektiøs sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DH750C Mastoiditis tuberculosa 01-01-1994 31-12-2011
DH758 Anden sygdom i mellemøre/processus mastoideus ved sygdom KA 01-01-1994
DH80 Otosklerose 01-01-1994
DH800 Otosklerose som involv. det ovale vindue, ikke-oblitererende 01-01-1994
DH801 Otosklerose som involverer det ovale vindue, oblitererende 01-01-1994
DH802 Kokleær otosklerose 01-01-1994
DH802A Otosclerosis capsulae oticae 01-01-1994 31-12-2011
DH802B Otosclerosis fenestrae cochleae 01-01-1994 31-12-2011
DH808 Anden form for otosklerose 01-01-1994
DH809 Otosklerose UNS 01-01-1994
DH81 Forstyrrelser i ligevægtssansen 01-01-1994
DH810 Ménières sygdom 01-01-1994
DH810A Endolymfatisk hydrops 01-01-1994
DH811 Vertigo paroxystica benigna 01-01-1994
DH812 Vestibularis neuritis 01-01-1994
DH813 Anden form for perifer vertigo 01-01-1994
DH813A Lermoyez' syndrom 01-01-1994
DH813B Vertigo auralis labyrinthica 01-01-1994
DH813C Perifer vertigo UNS 01-01-1994
DH813D Otogen vertigo 01-01-1994
DH814 Central vertigo 01-01-1994
DH814A Nystagmus positionalis centralis 01-01-1994
DH818 Anden forstyrrelse i ligevægtssansen 01-01-1994
DH819 Forstyrrelse i ligevægtssansen UNS 01-01-1994
DH82 Svimmelhed ved sygdomme klassificeret andetsteds 01-01-1994
DH829 Vertigo ved sygdom klassificeret andetsteds 01-01-1994
DH83 Andre sygdomme i indre øre 01-01-1994
DH830 Labyrintitis 01-01-1994
DH830A Otitis interna 01-01-1994 31-12-2011
DH831 Labyrintfistel 01-01-1994
DH832 Labyrintdysfunktion 01-01-1994
DH832A Labyrinthypersensibilitet 01-01-1994
DH832B Labyrinthypofunktion 01-01-1994
DH833 Støjskade på indre øre 01-01-1994
DH833A Trauma acustica 01-01-1994
DH838 Anden sygdom i indre øre 01-01-1994
DH839 Sygdom i indre øre UNS 01-01-1994
DH90 Konduktivt og perceptivt høretab 01-01-1994
DH900 Dobbeltsidigt konduktivt høretab 01-01-1994
DH901 Enkeltsidigt konduktivt høretab m normal hør. på modsat side 01-01-1994
DH902 Konduktivt høretab UNS 01-01-1994
DH903 Dobbeltsidigt perceptivt høretab 01-01-1994
DH904 Enkeltsidigt perceptivt høretab m normal hør. på modsat side 01-01-1994
DH905 Perceptivt høretab UNS 01-01-1994
DH905A Neuralt høretab UNS 01-01-1994
DH905B Centralt høretab UNS 01-01-1994
DH905C Sensorisk høretab UNS 01-01-1994
DH905D Sensorineuralt høretab UNS 01-01-1994
DH905E Medfødt døvhed UNS 01-01-1994
DH906 Dobbeltsidigt blandet konduktivt og perceptivt høretab 01-01-1994
DH907 Enkeltsidigt bl. kond/perceptivt høretab m modsat norm. hør. 01-01-1994
DH908 Blandet konduktivt og perceptivt høretab UNS 01-01-1994
DH91 Andre former for høretab 01-01-1994
DH910 Ototoksisk høretab 01-01-1994
DH911 Aldersbetinget høretab 01-01-1994
DH912 Akut idiopatisk høretab 01-01-1994
DH912A Akut høretab UNS 01-01-1994
DH913 Døvstumhed IKA 01-01-1994
DH918 Andet høretab 01-01-1994
DH918A Medfødt ikke-arveligt høretab UNS 01-07-2010
DH918A1 Medfødt ikke-arveligt høretab, asfyksi 01-07-2010
DH918A2 Medfødt ikke-arveligt høretab, rhesus-immunisering 01-07-2010
DH918A3 Medfødt ikke-arveligt høretab, CMV 01-07-2010
DH918A4 Medfødt ikke-arveligt høretab, toxoplasmose 01-07-2010
DH918A5 Medfødt ikke-arveligt høretab, rubella 01-07-2010
DH919 Høretab UNS 01-01-1994
DH919A Høretab for høje toner UNS 01-01-1994
DH919B Høretab for dybe toner UNS 01-01-1994
DH92 Øresmerter og øreflåd 01-01-1994
DH920 Øresmerter 01-01-1994
DH921 Øreflåd 01-01-1994
DH922 Blødning fra øre 01-01-1994
DH93 Andre øresygdomme IKA 01-01-1994
DH930 Degenerativ eller vaskulær sygdom i øre 01-01-1994
DH930A Degenerativ lidelse i øre 01-01-1994
DH930B Vaskulær lidelse i øre 01-01-1994
DH930C Forbigående iskæmisk døvhed 01-01-1994
DH931 Tinnitus 01-01-1994
DH932 Anden perceptiv hørelidelse 01-01-1994
DH932A Diplacusis 01-01-1994
DH932B Hyperacusis 01-01-1994
DH932C Temporære skift i høretærskel 01-01-1994
DH933 Sygdom i hørenerven 01-01-1994
DH933A Auditiv neuropati 01-04-2006
DH933B Auditory processing disorder (APD) 01-04-2006
DH938 Anden øresygdom 01-01-1994
DH938A Sent arveligt høretab 01-01-2011
DH939 Sygdom i øre UNS 01-01-1994
DH94 Andre øresygdomme ved sygdom klassificeret andetsteds 01-01-1994
DH940 Auditiv neuropati ved infektiøs eller parasitær sygdom KA 01-01-1994
DH940A Neuritis nervi acustici syphilitica 01-01-1994 31-12-2011
DH940B Neuritis nervi acustici ved infektiøs sygd klass andetsteds 01-01-1994 31-12-2011
DH940C Neuritis nervi acustici ved parasitær sygd klass andetsteds 01-01-1994 31-12-2011
DH948 Anden øresygdom ved sygdom klassificeret andetsteds 01-01-1994
DH948A Immunologisk høretab 01-01-2011
DH95 Sygdomme i øre og processus mastoideus efter indgreb IKA 01-01-1994
DH950 Recidiverende kolesteatom i kavitet efter mastektomi 01-01-1994
DH951 Anden følgetilstand efter mastoidektomi 01-01-1994
DH951A Mukøs cyste i kavitet efter mastoidektomi 01-01-1994
DH951B Granulationsvæv i kavitet efter mastoidektomi 01-01-1994
DH951C Kronisk mastoiditis efter mastoidektomi 01-01-1994
DH958 Anden sygdom i øre eller processus mastoideus efter indgreb 01-01-1994
DH959 Sygdom i øre eller processus mastoideus efter indgreb UNS 01-01-1994
DI00 Gigtfeber uden affektion af hjertet 01-01-1994
DI009 Gigtfeber uden hjertesygdom 01-01-1994
DI009A Subakut reumatisk feber UNS 01-01-1994
DI009B Akut reumatisk feber UNS 01-01-1994
DI01 Akut gigtfeber med affektion af hjertet 01-01-1994
DI010 Akut reumatisk perikarditis 01-01-1994
DI011 Akut reumatisk endokarditis 01-01-1994
DI011A Akut reumatisk hjerteklapsygdom 01-01-1994
DI012 Akut reumatisk myokarditis 01-01-1994
DI018 Anden form for akut reumatisk hjertesygdom 01-01-1994
DI018A Akut reumatisk pankarditis 01-01-1994
DI019 Akut reumatisk hjertesygdom UNS 01-01-1994
DI02 Reumatisk chorea 01-01-1994
DI020 Reumatisk chorea med affektion af hjertet 01-01-1994
DI020A Chorea UNS med affektion af hjertet 01-01-1994
DI029 Reumatisk chorea uden affektion af hjertet 01-01-1994
DI05 Reumatiske affektioner af mitralklappen 01-01-1994
DI050 Reumatisk mitralstenose 01-01-1994
DI051 Reumatisk mitralinsufficiens 01-01-1994
DI052 Reumatisk mitralstenose med insufficiens 01-01-1994
DI058 Anden form for reumatisk mitralklapaffektion 01-01-1994
DI059 Reumatisk mitralklapaffektion UNS 01-01-1994
DI06 Reumatiske affektioner af aortaklappen 01-01-1994
DI060 Reumatisk aortaklapstenose 01-01-1994
DI061 Reumatisk aortaklapinsufficiens 01-01-1994
DI062 Reumatisk aortaklapstenose med insufficiens 01-01-1994
DI068 Anden form for reumatisk aortaklapaffektion 01-01-1994
DI069 Reumatisk aortaklapaffektion UNS 01-01-1994
DI07 Reumatiske affektioner af trikuspidalklappen 01-01-1994
DI070 Reumatisk trikuspidalstenose 01-01-1994
DI071 Reumatisk trikuspidalinsufficiens 01-01-1994
DI072 Reumatisk trikuspidalstenose med insufficiens 01-01-1994
DI078 Anden form for reumatisk trikuspidalklapaffektion 01-01-1994
DI079 Reumatisk trikuspidalklapaffektion UNS 01-01-1994
DI08 Affektioner af flere hjerteklapper 01-01-1994
DI080 Affektioner af både mitralklap og aortaklap 01-01-1994
DI080A Reumatisk affektion af både mitralklap og aortaklap 01-01-1994
DI081 Affektioner af både mitralklap og trikuspidalklap 01-01-1994
DI081A Reumatisk affektion af både mitralklap og trikuspidalklap 01-01-1994
DI082 Affektion af både trikuspidalklap og aortaklap 01-01-1994
DI082A Reumatisk affektion af både trikuspidalklap og aortaklap 01-01-1994
DI083 Affektioner af både mitralklap, trikuspidalklap og aortaklap 01-01-1994
DI083A Reumat. aff. af både mitralklap, trikuspidalklap, aortaklap 01-01-2012
DI088 Anden form for affektion inddragende flere hjerteklapper 01-01-1994
DI089 Affektion af flere hjerteklapper UNS 01-01-1994
DI09 Andre reumatiske hjertesygdomme 01-01-1994
DI090 Reumatisk myokarditis 01-01-1994
DI091 Reumatisk endokarditis uden angivelse af afficeret klap 01-01-1994
DI091A Kronisk reumatisk endokarditis 01-01-1994
DI091B Kronisk reumatisk hjerteklapsygdom 01-01-1994
DI092 Kronisk reumatisk perikarditis 01-01-1994
DI092A Reumatisk perikardieadhærence 01-01-1994
DI092B Kronisk reumatisk mediastinoperikarditis 01-01-1994
DI092C Kronisk reumatisk myoperikarditis 01-01-1994
DI098 Anden reumatisk hjertesygdom 01-01-1994
DI098A Reumatisk pulmonalklapstenose med insufficiens 01-01-1994
DI098B Reumatisk pulmonalklapinsufficiens 01-01-1994
DI098C Reumatisk pulmonalklapaffektion UNS 01-01-1994
DI098D Pulmonalklapsygdom, reumatisk uden specifikation 01-01-1994 31-12-2011
DI098E Reumatisk pulmonalklapstenose 01-01-1994
DI099 Reumatisk hjertesygdom UNS 01-01-1994
DI099A Reumatisk hjertesvigt 01-01-2012
DI10 Blodtryksforhøjelse af ukendt årsag 01-01-1994
DI109 Essentiel hypertension 01-01-1994
DI11 Hypertensiv hjertesygdom 01-01-1994
DI110 Hypertensiv hjertesygdom med inkompenseret hjertesvigt 01-01-1994
DI119 Hypertensiv hjertesygdom uden inkompensation 01-01-1994
DI119A Hypertensiv hjertesygdom UNS 01-01-2012
DI12 Hypertensiv nyresygdom 01-01-1994
DI120 Hypertensiv nyresygdom med nyresvigt 01-01-1994
DI129 Hypertensiv nyresygdom uden nyresvigt 01-01-1994
DI129A Hypertensiv nyresygdom UNS 01-01-2012
DI13 Blodtryksforhøjelse med både hjertesygdom og nyresygdom 01-01-1994
DI130 Hypertensiv hjertesygdom og nyresygdom med hjertesvigt 01-01-1994
DI131 Hypertensiv hjertesygdom og nyresygdom med nyresvigt 01-01-1994
DI132 Hypertensiv hjertesygd. og nyresygd. m. hjerte- og nyresvigt 01-01-1994
DI139 Hypertensiv hjertesygdom og nyresygdom UNS 01-01-1994
DI15 Blodtryksforhøjelse med kendt årsag 01-01-1994
DI150 Renovaskulær hypertension 01-01-1994
DI151 Hypertension sekundært til anden nyresygdom 01-01-1994
DI152 Hypertension sekundært til endokrin sygdom 01-01-1994
DI158 Anden form for sekundær hypertension 01-01-1994
DI159 Sekundær hypertension UNS 01-01-1994
DI20 Angina pectoris 01-01-1994
DI200 Ustabil angina pectoris 01-01-1994
DI200A Praeinfarkt syndrom 01-01-1994 30-06-2006
DI200B Klinisk vurderet ustabil angina pectoris 01-07-2006
DI200C Ustabil angina pectoris med dokumenteret iskæmi 01-07-2006
DI201 Prinzmetals angina pectoris 01-01-1994
DI201A Angina pectoris, variant 01-01-1994 30-06-2006
DI201B Angina pectoris, Prinzmetal 01-01-1994 30-06-2006
DI208 Anden form for angina pectoris 01-01-1994
DI208A Angina pectoris, anstrengelsesudløst 01-01-1994 30-06-2006
DI208B Stenocardia 01-01-1994 30-06-2006
DI208D Mikrovaskulær angina 01-07-2006
DI208E Stabil angina pectoris 01-01-2016
DI208E1 Klinisk vurderet angina pectoris 01-10-2016
DI208E2 Angina pectoris med dokumenteret iskæmi 01-10-2016
DI209 Angina pectoris UNS 01-01-1994
DI21 Akut myokardieinfarkt 01-01-1994
DI210 Anteriort akut myokardieinfarkt med Q-taksudvikling 01-01-1994
DI210A Anteriort non-ST-elevations AMI med Q-taksudvikling 01-07-2006
DI210B Anteriort ST-elevations akut myokardieinfarkt med Q-taksudv. 01-07-2006
DI211 Inferiort/posteriort akut myokardieinfarkt med Q-taksudv. 01-01-1994
DI211A Inferiort el posteriort non-ST-elevations AMI m Q-taksudvikl 01-07-2006
DI211B Inferiort el posteriort ST-elevations AMI m Q-taksudvikling 01-07-2006
DI212 Infarctus myocardii acutus transmuralis m anden lokalisatio 01-01-1994 30-06-2006
DI212A Infarctus myocardii acutus transmuralis posterolateralis 01-01-1994 30-06-2006
DI212B Infarctus myocardii acutus transmuralis septalis 01-01-1994 30-06-2006
DI212C Infarctus myocardii acutus transmuralis posterobasalis 01-01-1994 30-06-2006
DI212D Infarctus myocardii acutus transmuralis posteroseptalis 01-01-1994 30-06-2006
DI212E Infarctus myocardii acutus transmuralis apicolateralis 01-01-1994 30-06-2006
DI212F Infarctus myocardii acutus transmuralis basolateralis 01-01-1994 30-06-2006
DI212G Infarctus myocardii acutus transmuralis lateralis 01-01-1994 30-06-2006
DI212H Infarctus myocardii acutus transmuralis posterioris 01-01-1994 30-06-2006
DI213 ST-elevations akut myokardieinfarkt 01-01-1994
DI213A ST-elevations akut myokardieinfarkt, anteriort 01-01-2020
DI213B ST-elevations akut myokardieinfarkt, inferiort/posteriort 01-01-2020
DI213C ST-elevations akut myokardieinfarkt, grenblok 01-01-2020
DI214 Non-ST-elevations akut myokardieinfarkt 01-01-1994
DI219 Akut myokardieinfarkt UNS 01-01-1994
DI219A Type 2 myokardieinfarkt 01-01-2020
DI22 Tilbagevendende akut hjerteinfarkt 01-01-1994 30-06-2006
DI220 Infarctus myocardii acutus recidivans anterioris 01-01-1994 30-06-2006
DI220A Infarctus myocardii acutus recidivans anteroseptalis 01-01-1994 30-06-2006
DI220B Infarctus myocardii acutus recidivans anterolateralis 01-01-1994 30-06-2006
DI220C Infarctus myocardii acutus recidivans anteroapicalis 01-01-1994 30-06-2006
DI221 Infarctus myocardii acutus recidivans inferioris 01-01-1994 30-06-2006
DI221A Infarctus myocardii acutus recidivans inferoposterioris 01-01-1994 30-06-2006
DI221B Infarctus myocardii acutus recidivans inferolateralis 01-01-1994 30-06-2006
DI221C Infarctus myocardii acutus recidivans diaphragmatica 01-01-1994 30-06-2006
DI228 Infarctus myocardii acutus recidivans m anden lokalisation 01-01-1994 30-06-2006
DI228A Infarctus myocardii acutus recidivans posteroseptalis 01-01-1994 30-06-2006
DI228B Infarctus myocardii acutus recidivans posterolateralis 01-01-1994 30-06-2006
DI228C Infarctus myocardii acutus recidivans septalis 01-01-1994 30-06-2006
DI228D Infarctus myocardii acutus recidivans apicolateralis 01-01-1994 30-06-2006
DI228E Infarctus myocardii acutus recidivans basolateralis 01-01-1994 30-06-2006
DI228F Infarctus myocardii acutus recidivans lateralis 01-01-1994 30-06-2006
DI228G Infarctus myocardii acutus recidivans posterioris 01-01-1994 30-06-2006
DI228H Infarctus myocardii acutus recidivans posterobasalis 01-01-1994 30-06-2006
DI229 Infarctus myocardii acutus recidivans uden specifikation 01-01-1994 30-06-2006
DI23 Komplikationer i efterforløbet af akut myokardieinfarkt 01-01-1994
DI230 Hæmoperikardium efter akut myokardieinfarkt 01-01-1994
DI231 Atrieseptumruptur efter akut myokardieinfarkt 01-01-1994
DI232 Ventrikelseptumruptur efter akut myokardieinfarkt 01-01-1994
DI233 Ruptur i hjertevæg u hæmoperikardium eft AMI 01-01-1994
DI234 Ruptur af chordae tendineae efter akut myokardieinfarkt 01-01-1994
DI235 Papillærmuskelruptur efter akut myokardieinfarkt 01-01-1994
DI236 Trombose i atrie eller ventrikel efter akut myokardieinfarkt 01-01-1994
DI236A Trombose i atrieaurikel efter akut myokardieinfarkt 01-01-1994
DI236B Trombose i ventrikel akut myokardieinfarkt 01-01-1994
DI238 An. akut kompl. i efterforløbet af AMI 01-01-1994
DI238A Perikardieansamling efter akut myokardieinfarkt 01-07-2006
DI24 Andre former for akut iskæmisk hjertesygdom 01-01-1994
DI240 Koronartrombose uden infarkt 01-01-1994
DI240A Arteriel eller venøs koronaremboli uden infarkt 01-01-1994
DI241 Postmyokardieinfarktsyndrom 01-01-1994
DI241A Dressler's syndrom 01-01-1994 31-12-2011
DI248 Anden form for akut iskæmisk hjertesygdom 01-01-1994
DI248A Insufficientia coronaria 01-01-1994
DI249 Akut iskæmisk hjertesygdom UNS 01-01-1994
DI25 Kronisk iskæmisk hjertesygdom 01-01-1994
DI250 Arteriosclerosis cardiovascularis 01-01-1994 30-06-2006
DI251 Arteriosklerotisk hjertesygdom 01-01-1994
DI251A Ateriosclerosis arteriae coronariae 01-01-1994 30-06-2006
DI251B Klinisk vurderet angina pectoris 01-07-2006 30-09-2016
DI251C Angina pectoris med dokumenteret iskæmi 01-07-2006 30-09-2016
DI252 Gammelt myokardieinfarkt 01-01-1994
DI252A Tidligere myokardieinfarkt (non-Q-tak) 01-07-2006
DI252B Tidligere myokardieinfarkt (Q-tak, anteriort) 01-07-2006
DI252C Tidligere myokardieinfarkt (Q-tak, inferiort/posteriort) 01-07-2006
DI253 Hjerteaneurisme 01-01-1994
DI254 Koronararterieaneurisme og -dissektion 01-01-1994
DI254A Fistula arteriovenosa coronaria acquisita 01-01-1994
DI254B Spontan Koronararteriedissektion (SKAD) 01-01-2020
DI255 Iskæmisk kardiomyopati 01-01-1994
DI256 Stum myokardieiskæmi 01-01-1994
DI256A Søvnrelateret iskæmisk hjertesygdom 01-04-2006 31-12-2011
DI258 Anden form for kronisk iskæmisk hjertesygdom 01-01-1994
DI259 Kronisk iskæmisk hjertesygdom UNS 01-01-1994
DI26 Blodprop i lunge 01-01-1994
DI260 Lungeemboli med akut cor pulmonale 01-01-1994
DI260A Akut cor pulmonale UNS 01-01-1994
DI269 Lungeemboli uden akut cor pulmonale 01-01-1994
DI269A Lungeemboli UNS 01-01-1994
DI27 Anden pulmonal hjertesygdom 01-01-1994
DI270 Essentiel pulmonal arteriel hypertension 01-01-1994
DI271 Kyfoskoliotisk hjertesygdom 01-01-1994
DI272 Kronisk tromboembolisk pulmonal hypertension 01-07-2006
DI278 Anden pulmonal hjertesygdom 01-01-1994
DI278A Eisenmengers syndrom 01-01-2012
DI279 Pulmonal hjertesygdom UNS 01-01-1994
DI279A Cor pulmonale UNS 01-07-2006
DI28 Andre sygdomme i lungekredsløbet 01-01-1994
DI280 Pulmonal arteriovenøs fistel 01-01-1994
DI281 Aneurisme i lungearterie 01-01-1994
DI288 Anden sygdom i lungekredsløbet 01-01-1994
DI288A Ruptur af lungekar 01-01-1994
DI288B Stenose i lungekar 01-01-1994
DI289 Sygdom i lungekredsløb UNS 01-01-1994
DI30 Akut perikarditis 01-01-1994
DI300 Akut idiopatisk perikarditis 01-01-1994
DI301 Akut infektiøs perikarditis 01-01-1994
DI301A Perikarditis forårsaget af pneumokokker 01-01-1994
DI301B Purulent perikarditis 01-01-1994
DI301C Perikarditis forårsaget af stafylokokker 01-01-1994
DI301D Perikarditis forårsaget af streptokokker 01-01-1994
DI301E Perikarditis forårsaget af virus 01-01-1994
DI308 Anden form for akut perikardititis 01-01-1994
DI309 Akut perikarditis UNS 01-01-1994
DI31 Andre sygdomme i hjertesækken 01-01-1994
DI310 Kronisk adhesiv perikarditis 01-01-1994
DI310A Accretio cordis 01-01-1994 31-12-2011
DI310B Perikardieadhærencer 01-01-1994
DI310C Kronisk mediastinoperikarditis med adhærencer 01-01-1994
DI311 Kronisk konstriktiv perikarditis 01-01-1994
DI311A Forkalkning i perikardiet 01-01-1994
DI311B Pericarditis constrictiva chronica 01-01-1994 31-12-2011
DI312 Hæmoperikardium ikke klasssificeret andetsteds 01-01-1994
DI313 Non-inflammatorisk ekssudativ perikarditis 01-01-1994
DI313A Kyloperikardium 01-01-1994
DI318 Anden sygdom i perikardiet 01-01-1994
DI318A Fokale perikardieadhæsioner 01-01-1994
DI318B Kronisk (recidiverende) perikarditis UNS 01-01-1994
DI319 Sygdom i perikardiet UNS 01-01-1994
DI319A Hjertetamponade 01-01-1994
DI32 Perikarditis ved sygdomme klassificeret andetsteds 01-01-1994
DI320 Perikarditis ved bakteriel sygdom klassificeret andetsteds 01-01-1994
DI320A Pericarditis gonococcica 01-01-1994 31-12-2011
DI320B Pericarditis meningococcica 01-01-1994 31-12-2011
DI320C Pericarditis syphilitica 01-01-1994 31-12-2011
DI320D Pericarditis tuberculosa 01-01-1994 31-12-2011
DI321 Perikarditis ved anden infektiøs eller parasitær sygdom KA 01-01-1994
DI321A Pericarditis ved parasitær sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DI321B Pericarditis ved infektiøs sygdom klassificeret andetsteds 01-01-1994 31-12-2011
DI328 Perikarditis ved anden sygdom klassificeret andetsteds 01-01-1994
DI328A Pericarditis rheumatoides 01-01-1994 31-12-2011
DI328B Pericarditis, systemisk lupus erythematosus 01-01-1994 31-12-2011
DI328C Pericarditis uraemica 01-01-1994 31-12-2011
DI33 Akut og subakut endokarditis 01-01-1994
DI330 Akut eller subakut infektiøs endokarditis 01-01-1994
DI330A Endocarditis infectiosa subacuta 01-01-1994 30-06-2006
DI330B Endocarditis infectiosa chronica 01-01-1994 30-06-2006
DI330C Endocarditis lenta 01-01-1994 30-06-2006
DI330D Endocarditis ulcerativa acuta 01-01-1994 30-06-2006
DI330E Endocarditis ulcerativa subacuta 01-01-1994 30-06-2006
DI330F Endocarditis ulcerativa chronica 01-01-1994 30-06-2006
DI339 Akut endokarditis UNS 01-01-1994
DI34 Ikke-reumatiske sygdomme i mitralklappen 01-01-1994
DI340 Mitralinsufficiens 01-01-1994
DI341 Mitralklapsprolaps 01-01-1994
DI342 Ikke-reumatisk mitralstenose 01-01-1994
DI348 Anden sygdom i mitralklap 01-01-1994
DI348A Sekundær mitralinsufficiens 01-07-2006
DI349 Ikke-reumatisk mitralklaplidelse UNS 01-01-1994
DI35 Ikke-reumatiske sygdomme i aortaklappen 01-01-1994
DI350 Aortastenose 01-01-1994
DI351 Aortainsufficiens 01-01-1994
DI352 Aortastenose med insufficiens 01-01-1994
DI358 Anden form for aortaklapsygdom 01-01-1994
DI358A Aortaklapsklerose 01-07-2006
DI359 Aortaklapsygdom UNS 01-01-1994
DI36 Ikke-reumatiske sygdomme i trikuspidalklappen 01-01-1994
DI360 Ikke-reumatisk trikuspidalstenose 01-01-1994
DI361 Ikke-reumatisk trikuspidalinsufficiens 01-01-1994
DI362 Ikke-reumatisk trikuspidalklapstenose med insufficiens 01-01-1994
DI368 Anden form for ikke-reumatisk trikuspidalklapsygdom 01-01-1994
DI368A Sekundær trikuspidalinsufficiens 01-07-2006
DI369 Ikke-reumatisk trikuspidalklapsygdom UNS 01-01-1994
DI37 Sygdomme i pulmonalklappen 01-01-1994
DI370 Pulmonalklapstenose 01-01-1994
DI371 Pulmonalklapinsufficiens 01-01-1994
DI372 Pulmonalklapstenose med insufficiens 01-01-1994
DI378 Anden form for pulmonalklapsygdom 01-01-1994
DI379 Pulmonalklapsygdom UNS 01-01-1994
DI38 Endokarditis uden angivelse klapaffektion 01-01-1994
DI389 Endokarditis UNS 01-01-1994
DI39 Endokarditis og lidelser i hjerteklapper ved sygdomme KA 01-01-1994
DI390 Affektion af mitralklappen ved sygdom klas. andetsteds 01-01-1994
DI391 Affektion af aortaklappen v. sygdom klassificeret andetsteds 01-01-1994
DI392 Affektion af trikuspidalklappen ved sygdom klas. andetsteds 01-01-1994
DI393 Affektion af pulmonalklappen ved sygdom klas. andetsteds 01-01-1994
DI394 Affektion af flere hjerteklapper ved sygdom klas. andetsteds 01-01-1994
DI398 Endokarditis UNS ved sygdom klassificeret andetsteds 01-01-1994
DI398A Endocarditis, candidiasis 01-01-1994 31-12-2011
DI398B Endocarditis gonococcica 01-01-1994 31-12-2011
DI398C Endocarditis, Libman-Sacks, systemisk lupus erythematosus 01-01-1994 31-12-2011
DI398D Endocarditis meningococcica 01-01-1994 31-12-2011
DI398E Endocarditis rheumatoides 01-01-1994 31-12-2011
DI398F Endocarditis syphilitica 01-01-1994 31-12-2011
DI398G Endocarditis tuberculosa 01-01-1994 31-12-2011
DI398H Endocarditis typhoidea 01-01-1994 31-12-2011
DI40 Akut myokarditis 01-01-1994
DI400 Infektiøs myokarditis 01-01-1994
DI400A Myocarditis septica 01-01-1994 30-06-2006
DI400B Myocarditis viralis 01-01-1994 30-06-2006
DI401 Idiopatisk myokarditis 01-01-1994
DI408 Anden form for akut myokarditis 01-01-1994
DI408A Toxisk myokarditis 01-01-2012
DI409 Akut myokarditis UNS 01-01-1994
DI41 Myokarditis ved sygdom klassificeret andetsteds 01-01-1994
DI410 Myokarditis ved bakteriel sygdom klassificeret andetsteds 01-01-1994
DI410A Myocarditis diphtheritica 01-01-1994 31-12-2011
DI410B Myocarditis gonococcica 01-01-1994 31-12-2011
DI410C Myocarditis meningococcica 01-01-1994 31-12-2011
DI410D Myocarditis syphilitica 01-01-1994 31-12-2011
DI410E Myocarditis tuberculosa 01-01-1994 31-12-2011
DI411 Myokarditis ved viral sygdom klassificeret andetsteds 01-01-1994
DI411A Myocarditis, influenza 01-01-1994 31-12-2011
DI411B Myocarditis, parotitis 01-01-1994 31-12-2011
DI412 Myokarditis ved anden infektiøs eller parasitær sygdom KA 01-01-1994
DI412A Myocarditis, morbus Chagas 01-01-1994 31-12-2011
DI412B Myocarditis, toxoplasmosis 01-01-1994 31-12-2011
DI418 Myokarditis ved anden sygdom klassificeret andetsteds 01-01-1994
DI418A Myocarditis rheumatoides 01-01-1994 31-12-2011
DI418B Myocarditis sarcoidosa 01-01-1994 31-12-2011
DI42 Kardiomyopati 01-01-1994
DI420 Dilateret kardiomyopati 01-01-1994
DI421 Obstruktiv hypertrofisk kardiomyopati 01-01-1994
DI421A Hypertrofisk subaortastenose 01-01-1994
DI422 Hypertrofisk kardiomyopati, non-obstruktiv 01-01-1994
DI423 Endomyocarditis eosinophilica 01-01-1994
DI423A Fibrosis endomyocardii tropica 01-01-1994
DI423B Löfflers endokarditis 01-01-1994
DI424 Fibroelastosis endocardii 01-01-1994
DI424A Medfødt kardiomyopati 01-01-1994
DI425 Anden form for restriktiv kardiomyopati 01-01-1994
DI426 Alkoholisk kardiomyopati 01-01-1994
DI427 Kardiomyopati forårsaget af lægemiddel eller andet agens 01-01-1994
DI428 Anden form for kardiomyopati 01-01-1994
DI428A Arytmogen højre ventrikel dysplasi (ARVD) 01-07-2006
DI428B Takotsubo kardiomyopati 01-01-2009
DI429 Kardiomyopati UNS 01-01-1994
DI43 Kardiomyopati ved sygdom klassificeret andetsteds 01-01-1994
DI430 Kardiomyopati ved infektiøs eller parasitær sygdom KA 01-01-1994
DI430A Cardiomyopathia diphtheritica 01-01-1994 31-12-2011
DI430B Cardiomyopathia ved parasitær sygd klassificeret andetsteds 01-01-1994 31-12-2011
DI430C Cardiomyopathia ved infektiøs sygd klassificeret andetsteds 01-01-1994 31-12-2011
DI431 Kardiomyopati ved metabolisk sygdom klassificeret andetsteds 01-01-1994
DI431A Amyloidosis cordis 01-01-1994 31-12-2011
DI432 Kardiomyopati ved ernæringssygdom klassificeret andetsteds 01-01-1994
DI432A Cardiomyopathia nutritionalis 01-01-1994 31-12-2011
DI438 Kardiomyopati ved anden sygdom klassificeret andetsteds 01-01-1994
DI438A Cardiomyopathia thyrotoxica 01-01-1994 31-12-2011
DI438B Tophi urici cordis 01-01-1994 31-12-2011
DI44 Atrioventrikulært blok og venstresidigt grenblok 01-01-1994
DI440 1° Forlænget AV-overledning 01-01-1994
DI441 2° Intermitterende AV-overledning 01-01-1994
DI441A Möbitz blok type I og II 01-01-1994 30-06-2006
DI441B 2° intermitterende AV-overledning Type 1 01-01-1994
DI441C 2° intermitterende AV-overledning Type 2 01-07-2006
DI441D 2:1 AV overledning (blok) 01-07-2006
DI441E Avanceret AV blok m 2 el fl. konsekutive mangl. overledning 01-07-2006
DI442 3° Ophævet AV-overledning (AV-blok) 01-01-1994
DI442A Paroksystisk ophævet overledning (AV blok) 01-07-2006
DI443 Atrioventrikulært hjerteblok UNS 01-01-1994
DI443A Anden form for atrioventrikulært hjerteblok 01-01-1994
DI444 Venstresidigt anteriort fascikelblok 01-01-1994
DI445 Venstresidigt posteriort fascikelblok 01-01-1994
DI446 Andet eller ikke specificeret venstresidigt grenblok 01-01-1994
DI446A Venstresidigt atrioventrikulært hemiblok UNS 01-01-1994
DI446B Atrioventrikulært hemiblok UNS 01-01-1994
DI447 Venstresidigt grenblok UNS 01-01-1994
DI45 Andre ledningsforstyrrelser i hjertet 01-01-1994
DI450 Højresidigt fascikelblok 01-01-1994
DI451 Anden eller ikke specificeret form for højresidigt grenblok 01-01-1994
DI451A Højresidigt atrioventrikulært grenblok 01-01-1994
DI452 Bifascikulært blok 01-01-1994
DI453 Trifascikulært blok 01-01-1994
DI454 Intraventrikulært blok UNS 01-01-1994
DI455 Andet hjerteblok 01-01-1994
DI455A Sinusbradykardi 01-01-1994
DI455B Sinuatrialt blok 01-01-1994
DI455C Sinusarrest 01-01-1994
DI455G Atriventrikulær (nodal) eskapaderytme 01-07-2006
DI455H Accelereret atrioventrikulær (nodal) eskapaderytme 01-07-2006
DI455K Ventrikulær eskapaderytme 01-07-2006
DI455L Accelereret idioventrikulær rytme 01-07-2006
DI456 Præexcitationssyndrom 01-01-1994
DI456A Accessorisk ledningsbundt 01-01-1994
DI456AA Retrogradt ledende accessorisk ledningsbundt 01-07-2006
DI456B Lown-Ganong-Levines syndrom 01-01-1994
DI456C Wolff-Parkinson-White konfiguration m delta-tak u takykardi 01-01-1994
DI456D Wolff-Parkinson-Whites syndrom med delta-tak 01-01-1994
DI456DA Wolff-Parkinson-Whites syndrom med orthodrom takykardi 01-07-2006
DI456DB Wolff-Parkinson-Whites syndrom med antidrom takykardi 01-07-2006
DI456E Skjult Wolff-Parkinson-Whites syndrom 01-07-2006
DI458 Anden ledningsforstyrrelse i hjertet 01-01-1994
DI458M Supraventrikulær takykardi via Mahaimfibre 01-07-2006
DI458N Permanent reciprokerende junktional takykardi (PJRT) 01-07-2006
DI459 Ledningsforstyrrelse i hjertet UNS 01-01-1994
DI459A Adams-Stokes' syndrom 01-01-1994
DI46 Hjertestop 01-01-1994
DI460 Hjertestop med vellykket genoplivning 01-01-1994
DI461 Pludselig hjertedød 01-01-1994
DI469 Hjertestop UNS 01-01-1994
DI47 Anfaldsvis takykardi 01-01-1994
DI470 Ventrikulær takykardi (reentry) 01-01-1994
DI470A Ventrikulær takykardi med iskæmisk hjertesygdom 01-07-2006
DI470B Arytmogen højre ventrikel-takykardi 01-07-2006
DI470C Ventrikulær takykardi med anden strukturel hjertesygdom 01-07-2006
DI470D Idiopatisk (fascikulær) venstre-ventrikel takykardi 01-07-2006
DI470H Idiopatisk højre ventrikel-takykardi 01-07-2006
DI470HA Paroxysmatisk ventrik-takykardi, højre ventrikels udløbsdel 01-07-2006
DI470HB Repetitiv højre ventrikel-takykardi 01-07-2006
DI471 Supraventrikulær takykardi med smalle QRS-komplekser 01-01-1994
DI471A Tachycardia atrialis paroxysmatica 01-01-1994 30-06-2006
DI471B Tachycardia atrioventricularis paroxysmatica 01-01-1994 30-06-2006
DI471C Tachycardia nodalis paroxysmatica 01-01-1994 30-06-2006
DI471E Sinusarytmi 01-07-2006
DI471EA Fasisk sinusarytmi 01-07-2006
DI471EB Non-fasisk sinusarytmi 01-07-2006
DI471F Sinustakykardi 01-07-2006
DI471FA Fysiologisk sinustakykardi 01-07-2006
DI471G Sinusknude reentry takykardi 01-07-2006
DI471H Uhensigtsmæssig sinustakykardi 01-07-2006
DI471J Postural ortostatisk takykardisyndrom (POTS) 01-07-2006
DI471L Atrial takykardi 01-07-2006
DI471LA Atrial takykardi med intermitterende overledning 01-07-2006
DI471M Multifokal atrial takykardi 01-07-2006
DI471N Postoperativ reentry atrial takykardi 01-07-2006
DI471P AV junktional takykardi 01-07-2006
DI471PA Fokal junktional takykardi 01-07-2006
DI471PB Non-paroksysmatisk junktional takykardi 01-07-2006
DI471R AV nodal reentry takykardi (AVNRT) UNS 01-07-2006
DI471RA Almindelig form af AV nodal reentry takykardi (slow-fast) 01-07-2006
DI471RB Sjælden form af AV nodal reentry takykardi (fast-slow) 01-07-2006
DI471RC AV nodal reentry takykardi (slow-slow) 01-07-2006
DI471X Supraventrikulær takykardi med brede QRS-komplekser 01-07-2006
DI472 Ventrikulær takykardi 01-01-1994
DI472A Ventrikulær takykardi UNS 01-07-2006
DI472B Ventrikulær takykardi uden påviselig strukturel hjertesygdom 01-07-2006
DI472D Torsade de pointes ventrikulær takykardi 01-07-2006
DI472E Medfødt langt QT-syndrom 01-07-2006
DI472EA Romano-Ward medfødt langt QT-syndrom 01-07-2006
DI472EB Jervell-Lange-Nielsens medfødt langt QT-syndrom 01-07-2006
DI472F Erhvervet langt QT-syndrom 01-07-2006
DI472FA Langt QT-syndrom forårsaget af lægemiddel 01-07-2006
DI472H Polymorf ventrikulær takykardi uden langt QT-interval 01-07-2006
DI472L Brugadamønster i EKG 01-07-2006
DI472LA Brugadamønster i EKG, type 1 01-07-2006
DI472LB Brugadamønster i EKG, type 2 01-07-2006
DI472LC Brugadamønster i EKG, type 3 01-07-2006
DI472M Brugadas syndrom 01-07-2006
DI472N Kort QT-interval i EKG 01-07-2006
DI472NA Kort QT-syndrom 01-07-2006
DI478 Anden takykardi 01-07-2006
DI478A Takykardi med brede QRS-komplekser med ukendt mekanisme 01-07-2006
DI479 Paroksysmatisk takykardi UNS 01-01-1994
DI479A Bouveret-Hoffman's syndrom 01-01-1994 30-06-2006
DI48 Atrieflagren og atrieflimren 01-01-1994
DI480 Paroksysmatisk atrieflimren 01-07-2013
DI481 Persisterende atrieflimren 01-07-2013
DI482 Kronisk atrieflimren 01-07-2013
DI483 Typisk atrieflagren 01-07-2013
DI484 Atypisk atrieflagren 01-07-2013
DI489 Atrieflagren eller atrieflimren UNS 01-01-1994
DI489A Atrieflagren 01-01-1994 30-06-2013
DI489AA Almindelig typisk atrieflagren 01-07-2006 30-06-2013
DI489AB Reverse typisk atrieflagren 01-07-2006 30-06-2013
DI489AC Lower loop-atrieflagren 01-07-2006 30-06-2013
DI489AD Venstre atrie makro-reentry atrieflagren 01-07-2006 30-06-2013
DI489AE Postoperativ (ar) makro-reentry atrieflagren 01-07-2006 30-06-2013
DI489B Atrieflimren 01-01-1994 30-06-2013
DI489BA Atrieflimren, første anfald 01-07-2006 30-06-2013
DI489BB Paroksysmatisk atrieflimren 01-07-2006 30-06-2013
DI489BC Persisterende atrieflimren 01-07-2006 30-06-2013
DI489BD Permanent atrieflimren 01-07-2006 30-06-2013
DI49 Andre hjerterytmeforstyrrelser 01-01-1994
DI490 Ventrikelflagren eller ventrikelflimren 01-01-1994
DI490A Ventrikelflagren 01-01-1994
DI490B Ventrikelflimren 01-01-1994
DI490BA Idiopatisk ventrikelflimren 01-07-2006
DI491 Supraventrikulære ekstrasystoler 01-01-1994
DI491A Sinusknude-ekstrasystoler 01-07-2006
DI491B Atriale ekstrasystoler 01-07-2006
DI491C Overledte atriale ekstrasystoler 01-07-2006
DI491D Ikke-overledte atriale ekstrasystoler 01-07-2006
DI491E Multifokale atriale ekstrasystoler 01-07-2006
DI492 AV junktionale ekstrasystoler 01-01-1994
DI493 Ventrikulære ekstrasystoler 01-01-1994
DI493A Ventrikulære ekstrasystoler fra højre ventrikels udløbsdel 01-07-2006
DI493B Ventrikulære ekstrasystoler fra venstre ventrikel 01-07-2006
DI493C Ventrikulære ekstrasystoler fra ukendt sted 01-07-2006
DI494 Anden form for ekstrasystoli 01-01-1994
DI494A Ekstrasystoli UNS 01-01-1994
DI495 Syg sinusknude-syndrom 01-01-1994
DI495A Syg sinusknude syndrom 01-01-1994 30-06-2006
DI495B Takykardi-bradykardi syndrom 01-01-1994
DI498 Anden hjerterytmeforstyrrelse 01-01-1994
DI498A Eskapaderytme, nodal 01-01-1994 30-06-2006
DI498B Eskapaderytme, supraventrikulær 01-01-1994 30-06-2006
DI498C Tachycardia atrialis 01-01-1994 30-06-2006
DI498D Tachycardia nodalis 01-01-1994 30-06-2006
DI498E Tachycardia ventricularis 01-01-1994 30-06-2006
DI499 Hjerterytmeforstyrrelse UNS 01-01-1994
DI499A Søvnrelateret hjertearytmi 01-04-2006
DI50 Hjertesvigt 01-01-1994
DI500 Kronisk hjerteinsufficiens 01-01-1994
DI500A Højresidig hjerteinsufficiens 01-01-2009
DI501 Venstresidig hjerteinsufficiens 01-01-1994
DI501A Asthma cardiale 01-01-1994
DI501B Kardielt lungeødem 01-01-1994
DI501C Kardiel lungestase 01-01-1994
DI501D Biventrikulær hjerteinsufficiens 01-01-2012
DI502 Højresidig inkompenseret hjerteinfufficiens 01-07-2006 31-12-2008
DI503 Biventrikulær inkompenseret hjerteinsufficiens 01-07-2006 31-12-2008
DI508 Hjerteinsufficiens, andre former 01-07-2006 31-12-2008
DI508A Kompenseret hjerteinsufficiens 01-07-2006 31-12-2008
DI509 Hjertesvigt UNS 01-01-1994
DI509A Incompensatio cordis biventricularis 01-01-1994 30-06-2006
DI509B Biventrikulær hjerteinsufficiens 01-01-2009 31-12-2011
DI51 Dårligt def. hjertesygdomme og komplikationer til hjertesygd 01-01-1994
DI510 Erhvervet defekt i hjerteskillevæg 01-01-1994
DI510A Erhvervet ventrikelseptumdefekt 01-01-1994
DI510B Erhvervet atrieseptumdefekt 01-01-1994
DI511 Ruptur af chordae tendineae IKA 01-01-1994
DI511A Mitralklapinsufficiens ved chordaruptur 01-07-2006
DI512 Papillærmuskelruptur i hjertet IKA 01-01-1994
DI513 Intrakardiel trombose IKA 01-01-1994
DI513A Atrietrombose i hjertet IKA 01-01-1994
DI513B Aurikeltrombose i hjertet IKA 01-01-1994
DI513C Ventrikeltrombose i hjertet IKA 01-01-1994
DI514 Myokarditis UNS 01-01-1994
DI514A Myokardiefibrose 01-01-1994
DI514B Kronisk interstitiel myokarditis 01-01-1994
DI515 Myokardiedegeneration 01-01-1994
DI515A Degeneratio myocardii lipoidica 01-01-1994
DI515B Degeneratio myocardii senilis 01-01-1994
DI516 Kardiovaskulær sygdom UNS 01-01-1994
DI517 Kardiomegali 01-01-1994
DI517A Dilatatio cordis 01-01-1994
DI517B Dilatatio ventriculorum cordis 01-01-1994
DI517C Hjertehypertrofi 01-01-1994
DI518 Anden dårligt defineret hjertesygdom 01-01-1994
DI518A Akut karditis 01-01-1994
DI518B Kronisk karditis 01-01-1994
DI519 Hjertesygdom UNS 01-01-1994
DI52 Andre hjertesygdomme ved sygdomme klassificeret andetsteds 01-01-1994
DI520 Anden hjertesygdom ved bakteriel sygdom klas. andetsteds 01-01-1994
DI520A Carditis meningococcica ikke klassificeret andetsteds 01-01-1994 31-12-2011
DI521 Anden hjertesygdom v. an. infektiøs el. parasitær sygdom KA 01-01-1994
DI521A Hjertesygd ved andre infekt sygd klas andetsteds, anden for 01-01-1994 31-12-2011
DI521B Hjertesygd ved andre parasit sygd klass andetsteds, anden 01-01-1994 31-12-2011
DI521C Cor pulmonale ved sygdom klassificeret andetsteds 01-01-1994
DI528 Anden form for hjertesygdom v. anden sygdom klas. andetsteds 01-01-1994
DI528A Carditis rheumatoides 01-01-1994 31-12-2011
DI60 Subaraknoidalblødning 01-01-1994
DI600 Subaraknoidalblødning fra karotissifonen eller bifurkaturen 01-01-1994
DI601 Subaraknoidalblødning fra arteria cerebri media 01-01-1994
DI602 Subaraknoidalblødning fra arteria communicans anterior 01-01-1994
DI603 Subaraknoidalblødning fra arteria communicans posterior 01-01-1994
DI604 Subaraknoidalblødning fra arteria basilaris 01-01-1994
DI605 Subaraknoidalblødning fra arteria vertebralis 01-01-1994
DI606 Subaraknoidalblødning fra anden intrakraniel arterie 01-01-1994
DI606A Subaraknoidalblødning fra arteria cerebri posterior 01-01-1994
DI606B Subaraknoidalblødning fra arteria cerebri anterior 01-01-1994
DI606C Subaraknoidalblødning fra flere intrakranielle arterier 01-01-1994
DI606D Haemorrhagia subarachnoidalis, anden arterie 01-01-1994 31-12-2011
DI607 Subaraknoidalblødning fra intrakraniel arterie UNS 01-01-1994
DI607A Bristet medfødt intrakranielt sakkulært aneurisme 01-01-1994
DI608 Anden form for subaraknoidalblødning 01-01-1994
DI609 Subaraknoidalblødning UNS 01-01-1994
DI609A Bristet (medfødt) intrakranielt aneurisme UNS 01-01-2012
DI61 Hjerneblødning 01-01-1994
DI610 Subkortikal blødning i hjernehemisfære 01-01-1994
DI610A Dybtliggende blødning i hjernehemisfære 01-01-1994
DI611 Kortikal blødning i hjernehemisfære 01-01-1994
DI611A Blødning i hjernens overflade 01-01-1994
DI611B Haemorrhagia lobi cerebri 01-01-1994
DI612 Intracerebral blødning i hjernehemisfære UNS 01-01-1994
DI613 Blødning i hjernestammen 01-01-1994
DI614 Blødning i lillehjernen 01-01-1994
DI615 Blødning i hjerneventrikel 01-01-1994
DI616 Blødning flere steder i hjernen 01-01-1994
DI618 Anden form for hjerneblødning 01-01-1994
DI619 Hjerneblødning UNS 01-01-1994
DI62 Andre ikke-traumatiske intrakranielle blødninger 01-01-1994
DI620 Akut ikke-traumatisk subdural blødning 01-01-1994
DI621 Ikke-traumatisk epidural blødning 01-01-1994
DI629 Ikke-traumatisk intrakraniel blødning UNS 01-01-1994
DI63 Hjerneinfarkt 01-01-1994
DI630 Hjerneinfarkt forårsaget af trombose i præcerebral arterie 01-01-1994
DI631 Hjerneinfarkt forårsaget af emboli i præcerebral arterie 01-01-1994
DI632 Hjerneinfarkt f.a. tilluk./stenose i præcerebral arterie UNS 01-01-1994
DI633 Hjerneinfarkt forårsaget af trombose i cerebral arterie 01-01-1994
DI634 Hjerneinfarkt forårsaget af emboli i cerebral arterie 01-01-1994
DI634A Embolia cerebri 01-01-1994 31-12-2011
DI635 Hjerneinfarkt f.a. tillukning/stenose i cerebral arterie UNS 01-01-1994
DI636 Hjerneinfarkt f.a. ikke-pyogen cerebral venøs trombose 01-01-1994
DI638 Anden form for hjerneinfarkt 01-01-1994
DI639 Hjerneinfarkt UNS 01-01-1994
DI64 Slagtilfælde uden oplysning om blødning eller infarkt 01-01-1994
DI649 Apoplexia cerebri UNS 01-01-1994
DI65 Okklusioner og stenoser af præcerebrale arterier u/infarkt 01-01-1994
DI650 Okklusion/stenose af arteria vertebralis uden hjerneinfarkt 01-01-1994
DI650A Okklusion af arteria vertebralis uden hjerneinfarkt 01-01-1994
DI650B Stenose af arteria vertebralis uden hjerneinfarkt 01-01-1994
DI651 Okklusion el. stenose af arteria basilaris u. hjerneinfarkt 01-01-1994
DI651A Okklusion af arteria basilaris uden hjerneinfarkt 01-01-1994
DI651B Stenose af arteria basilaris uden hjerneinfarkt 01-01-1994
DI652 Okklusion el. stenose af arteria carotis uden hjerneinfarkt 01-01-1994
DI652A Okklusion af arteria carotis uden hjerneinfarkt 01-01-1994
DI652B Stenose af arteria carotis uden hjerneinfarkt 01-01-1994
DI653 Okklusion/stenose af fl/bilat præcerebrale aa. u/infarkt 01-01-1994
DI653A Okklusion af bilaterale præcerebrale aa. u/infarkt 01-01-1994
DI653B Okklusion af flere præcerebrale arterier u/infarkt 01-01-1994
DI653C Stenose flere præcerebrale arterier u/infarkt 01-01-1994
DI653D Stenose af bilaterale præcerebrale arterier u/infarkt 01-01-1994
DI658 Okklusion/stenose af an. præcerebral arterie u. hjerneinfar. 01-01-1994
DI659 Okklusion/stenose af præcerebral arterie u. hjerneinfa. UNS 01-01-1994
DI66 Okklusioner og stenoser af cerebrale arterier u/infarkt 01-01-1994
DI660 Okklus. el. stenose af arteria cerebri media u. hjerneinfa. 01-01-1994
DI660A Okklusion af arteria cerebri media u/infarkt 01-01-1994
DI660B Stenose af arteria cerebri media u/infarkt 01-01-1994
DI661 Okklusion/stenose af arteria cerebri anterior u. hjerneinfa. 01-01-1994
DI661A Okklusion af arteria cerebri anterior u/infarkt 01-01-1994
DI661B Stenose af arteria cerebri anterior u/infarkt 01-01-1994
DI662 Okklusion/steno. af arteria cerebri posterior u. hjerneinfa. 01-01-1994
DI662A Okklusion af arteria cerebri posterior u/infarkt 01-01-1994
DI662B Stenose af arteria cerebri posterior u/infarkt 01-01-1994
DI663 Okklusion el. stenose af cerebellar arterie u. hjerneinfarkt 01-01-1994
DI663A Okklusion af cerebellar arterie uden hjerneinfarkt 01-01-1994
DI663B Stenose af cerebellar arterie uden hjerneinfarkt 01-01-1994
DI664 Okklusion/stenose af fl/bilaterale cerebrale aa. u/infarkt 01-01-1994
DI664A Okklusion af bilaterale cerebrale arterier u/infarkt 01-01-1994
DI664B Okklusion af flere cerebrale arterier u/infarkt 01-01-1994
DI664C Stenose af bilaterale cerebrale arterier u/infarkt 01-01-1994
DI664D Stenose af flere cerebrale arterier u/infarkt 01-01-1994
DI668 Okklusion/stenose af an. cerebrale arterier u. hjerneinfarkt 01-01-1994
DI668A Okklusion af en el fl. af aa. perforantes cerebri u/infarkt 01-01-1994
DI669 Okklusion/stenose af cerebrale arterie UNS u. hjerneinfarkt 01-01-1994
DI67 Andre cerebrovaskulære sygdomme 01-01-1994
DI670 Dissektion af cerebral arterie uden ruptur 01-01-1994
DI671 Cerebralt aneurisme uden ruptur 01-01-1994
DI671A Erhvervet cerebral arteriovenøs fistel 01-01-1994
DI672 Cerebral aterosklerose 01-01-1994
DI672A Atheroma arteriae cerebri 01-01-1994
DI673 Progressiv vaskulær leukoencefalopati 01-01-1994
DI673A Binswangers sygdom 01-01-1994
DI674 Hypertensiv encefalopati 01-01-1994
DI675 Moyamoya-sygdom 01-01-1994
DI676 Ikke-pyogen intrakraniel venøs trombose 01-01-1994
DI676A Ikke-pyogen trombose i sinus venosi cerebri 01-01-1994
DI677 Cerebral arteritis IKA 01-01-1994
DI677A Primær cerebral vaskulitis 01-01-2011
DI678 Anden cerebrovaskulær sygdom 01-01-1994
DI678A Akut cerebrovaskulær insufficiens 01-01-1994
DI678B Cerebral (kronisk) iskæmi 01-01-1994
DI679 Cerebrovaskulær sygdom UNS 01-01-1994
DI68 Karforandringer i hjernen ved sygdomme klas. andetsteds 01-01-1994
DI680 Cerebral amyloid angiopati 01-01-1994
DI681 Cerebral arteritis ved infektiøs eller parasitær sygdom KA 01-01-1994
DI681A Arteritis cerebri ved infektiøs sygdom 01-01-1994 31-12-2011
DI681B Arteritis cerebri ved parasitær sygdom 01-01-1994 31-12-2011
DI681C Arteritis cerebri tuberculosa 01-01-1994 31-12-2011
DI681D Arteritis cerebri listerica 01-01-1994 31-12-2011
DI681E Arteritis cerebri syphilitica 01-01-1994 31-12-2011
DI682 Cerebral arteritis ved anden sygdom klassificeret andetsteds 01-01-1994
DI688 Anden karforandring i hjernen ved sygdom klas. andetsteds 01-01-1994
DI69 Senfølger efter karsygdomme i hjernen 01-01-1994
DI690 Senfølge efter tidligere subaraknoidalblødning 01-01-1994
DI691 Senfølge efter tidligere hjerneblødning 01-01-1994
DI692 Senfølge eft. tidl. an. art ikke-traum. intrakran. blødning 01-01-1994
DI693 Senfølge efter tidligere hjerneinfarkt 01-01-1994
DI694 Senfølge efter tidligere apoplexia cerebri 01-01-1994
DI698 Senfølge efter tidligere an/ikke spec. cerebrovaskulær sygd 01-01-1994
DI70 Åreforkalkning 01-01-1994
DI700 Aterosklerose i aorta 01-01-1994
DI701 Aterosklerose i nyrearterie 01-01-1994
DI702 Aterosklerose i arterie i underekstremitet 01-01-1994
DI702A Aterosklerotisk gangræn 01-01-1994
DI702B Mönckebergs mediasklerose 01-01-1994
DI708 Aterosklerose i anden arterie 01-01-1994
DI708A Aterosklerotisk retinopati 01-01-2012
DI709 Aterosklerose UNS 01-01-1994
DI71 Aorta-aneurisme og aortadissektion 01-01-1994
DI710 Aortadissektion UNS 01-01-1994
DI710A Aortadissektion, type A 01-07-2006
DI710B Aortadissektion, type B 01-07-2006
DI711 Rumperet torakalt aorta-aneurisme 01-01-1994
DI712 Torakalt aorta-aneurisme uden ruptur 01-01-1994
DI713 Rumperet abdominalt aorta-aneurisme 01-01-1994
DI714 Abdominalt aorta-aneurisme uden ruptur 01-01-1994
DI715 Rumperet torakoabdominalt aorta-aneurisme 01-01-1994
DI716 Torakoabdominalt aorta-aneurisme uden ruptur 01-01-1994
DI718 Rumperet aorta-aneurisme UNS 01-01-1994
DI719 Aorta-aneurisme UNS uden ruptur 01-01-1994
DI719A Dilateret aorta 01-01-1994
DI719B Hyalin nekrose i aorta 01-01-1994
DI72 Andre aneurismer 01-01-1994
DI720 Aneurisme på arteria carotis 01-01-1994
DI721 Aneurisme på arterie i overekstremitet 01-01-1994
DI722 Aneurisme på nyrearterie 01-01-1994
DI723 Aneurisme på arteria iliaca 01-01-1994
DI724 Aneurisme på arterie i underekstremitet 01-01-1994
DI725 Aneurisme i anden præcerebral arterie 01-01-2012
DI726 Aneurisme på arteria vertebralis 01-01-2013
DI728 Aneurisme med anden lokalisation 01-01-1994
DI729 Aneurisme UNS 01-01-1994
DI73 Andre sygdomme i perifere kar 01-01-1994
DI730 Raynauds syndrom 01-01-1994
DI731 Thromboangiitis obliterans 01-01-1994
DI738 Anden sygdom i perifere kar 01-01-1994
DI738A Akrocyanose 01-01-1994
DI738B Akroparæstesi 01-01-1994
DI738C Erytrocyanose 01-01-1994
DI738D Erytromelalgi 01-01-1994
DI738E Pseudokaposi 01-04-2000
DI739 Sygdom i perifere kar UNS 01-01-1994
DI739A Claudicatio intermittens 01-01-1994
DI739B Arteriespasme UNS 01-01-1994
DI739C Iskæmiske hvilesmerter i underekstremitet 01-01-1995
DI74 Emboli og trombose i arterier 01-01-1994
DI740 Emboli eller trombose i aorta abdominalis 01-01-1994
DI740A Bifurcatura aortae-syndrom 01-01-1994
DI740B Embolia aortae abdominalis 01-01-1994
DI740C Leriches syndrom 01-01-1994
DI740D Thrombosis aortae abdominalis 01-01-1994
DI741 Emboli eller trombose i aorta med anden/ikke spec. lokal. 01-01-1994
DI741A Emboli i aorta UNS 01-01-1994
DI741B Trombose i aorta UNS 01-01-1994
DI742 Emboli eller trombose i arterie i overekstremitet 01-01-1994
DI742A Emboli i arterie i overekstremitet 01-01-1994
DI742B Trombose i arterie i overekstremitet 01-01-1994
DI743 Emboli eller trombose i arterie i underekstremitet 01-01-1994
DI743A Emboli i arterie i underekstremitet 01-01-1994
DI743B Trombose i arterie i underekstremitet 01-01-1994
DI744 Emboli eller trombose i arterie i ekstremitet UNS 01-01-1994
DI744A Emboli i arterie i ekstremitet UNS 01-01-1994
DI744B Trombose i arterie i ekstremitet UNS 01-01-1994
DI744C Embolia arteriae periphericae 01-01-1994
DI744D Livedo reticularis (kolesterolembolier) 01-04-2000 31-12-2011
DI744E Kolesterol-emboli 01-04-2000 31-12-2011
DI745 Emboli eller trombose i arteria iliaca 01-01-1994
DI745A Emboli i arteria iliaca 01-01-1994
DI745B Trombose i arteria iliaca 01-01-1994
DI748 Emboli eller trombose i anden arterie 01-01-1994
DI749 Emboli eller trombose i arterie UNS 01-01-1994
DI77 Andre sygdomme i arterier og arterioler 01-01-1994
DI770 Erhvervet arteriovenøs fistel 01-01-1994
DI770A Varikøst aneurisme 01-01-1994
DI770B Erhvervet spinal arteriovenøs malformation 01-04-2019
DI771 Arteriestriktur 01-01-1994
DI772 Arterieruptur 01-01-1994
DI772A Erosio arteriae 01-01-1994
DI772B Fistula arteriae 01-01-1994
DI773 Fibromuskulær hyperplasi 01-01-1994
DI774 Arteria coeliaca-kompressionssyndrom 01-01-1994
DI775 Arterienekrose 01-01-1994
DI776 Arteritis UNS 01-01-1994
DI776A Endarteritis UNS 01-01-1994
DI778 Anden sygdom i arterier og arterioler 01-01-1994
DI778A Malign atrofisk papulose 01-04-2000
DI779 Sygdom i arterier og arterioler UNS 01-01-1994
DI78 Sygdomme i kapillærer 01-01-1994<